KEGG   Pseudoalteromonas espejiana: PESP_a1448Help
Entry
PESP_a1448        CDS       T04989                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pea  Pseudoalteromonas espejiana
Brite
Enzymes [BR:pea01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     PESP_a1448
Peptidases [BR:pea01002]
 Metallo Peptidases
  Family M2
   PESP_a1448
Exosome [BR:pea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PESP_a1448
CD molecules [BR:pea04090]
 Proteins
  PESP_a1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Reprolysin_5
Motif
Other DBs
NCBI-ProteinID: ASM49565
UniProt: A0A221I6T7
LinkDB All DBs
Position
I:complement(1380380..1382227)
Genome map
AA seq 615 aa AA seqDB search
MNTPRFKLSMSALIVASTLALSACEAEIAIDTTDSAQATKTITAKDANAFIAKTEKELSA
LYLESSRAEWIYANFITHDTSALSAEVNRKMTETVVRLANQAAQFDELELDYDARRKLNK
LKLALTLPAPQDEDKTAQLSTIVAELGGLYGKGKYCKDDGSCLSLGDMTSKMATSRDYNE
LLDLWQGWRQISKPMRPLYEQQVTLTNEGAKELGYTDTGAMWRSKYDMPADDFTKELDRI
WGQVKPLYNALHCHVRAKLGEKYGTDKVAQDEPIPAHLLGNMWAQAWGNIYDVVAPENAD
PGYDVTELLAKNNYDELKMVKGAETFFTSMGFEPLPETFYERSLFVKPKDRDVQCHASAW
NIDSKDDLRIKMCIQRTGEEFSVIHHELGHNFYQRAYNKQPLFYQESANDGFHEAIGDTI
ALSVTPGYLKEIGLLEQVPDESKDIGLLMKMALDKVAFVPFSLMVDQWRWQVFSGQVKPQ
DYNKAWWELREKYQGVQAPIARSEDDFDPGAKYHVPGNTPYTRYFLAHILQFEFHRSLCE
IAGNDKAIHRCSIYNSKEAGDKLNAMLEIGSSRPWQEALESITGKPQMDATAMLDYFAPL
QRYLDEQNKGRNCGW
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaccacgctttaaattaagtatgagcgccctaatagtcgcaagtactttagcg
ctgagcgcctgcgaagcagaaatagccatagacaccaccgattcagcacaagctacaaaa
acaataaccgcaaaagatgcaaacgcatttatagcaaaaacagaaaaagagttaagtgcg
ctttatttagaatcgagccgggcagagtggatatacgcaaattttattacccatgatacc
tcagcactttctgctgaagttaatcgtaaaatgaccgaaaccgttgtgcgtttagctaat
caagctgcgcagtttgatgaactcgaacttgattacgatgcgcgccgcaaacttaataag
cttaaactagcgcttactttacccgccccgcaagatgaagataaaacagcacaactttca
actattgtggcagagcttggtggtttatacggtaaaggtaaatactgtaaagacgatggc
agctgcttaagccttggcgacatgacgtcaaaaatggccaccagccgagattacaacgaa
ctacttgatttatggcaaggctggcgacaaatatcaaaaccaatgcgcccactttacgag
cagcaagttacacttaccaacgaaggtgctaaagagcttggttatactgatacaggtgca
atgtggcgcagtaaatacgatatgccagctgatgactttaccaaagagcttgaccgcatt
tgggggcaagtaaaaccgttatataacgctcttcactgtcatgttcgtgctaagttaggt
gaaaaatacggcaccgacaaagtagcccaagatgagccaatccctgcacatttactaggg
aacatgtgggcgcaagcgtggggtaacatttacgatgtagtcgcgccagaaaatgccgat
ccgggttacgatgtgaccgagctattagctaaaaataattacgacgagcttaaaatggta
aaaggagctgagaccttttttacctcaatgggatttgagccactgccagagaccttttac
gagcgctcactgtttgtaaaaccaaaagacagagatgtgcaatgtcatgcatctgcatgg
aatatagatagcaaagacgatttacgcattaaaatgtgtattcaacgcacgggcgaagag
ttctctgttattcaccatgagctaggccacaatttttatcagcgtgcttacaataaacag
cctttattttatcaagaaagtgcaaacgatggttttcatgaagccattggcgacactatt
gccctttcggttacaccaggctacttaaaagaaattggcttattagagcaagtacctgat
gaatctaaagacatcggcctattaatgaaaatggcccttgataaagtggcttttgtaccc
tttagcttaatggttgatcaatggcgttggcaggtattttcagggcaagtaaagccgcaa
gattataataaagcatggtgggaacttcgcgaaaaataccaaggtgtgcaagcgcctatt
gctcgtagcgaagacgactttgatcctggtgctaagtaccacgtcccgggtaatacacct
tatactcgttactttttagcgcatattttacagtttgagttccaccgtagtttatgtgaa
atagccggtaacgataaagcgattcatcgctgctctatttataactcaaaagaggcaggg
gataagctaaacgcaatgctagaaataggttcgtctcgcccatggcaagaagcccttgaa
agcattacaggcaaaccgcaaatggacgctacagccatgcttgattattttgcaccgctg
caacgctatttagatgagcagaacaaaggtcgtaactgcggctggtaa

DBGET integrated database retrieval system