KEGG   Pseudoalteromonas espejiana: PESP_a1689Help
Entry
PESP_a1689        CDS       T04989                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pea  Pseudoalteromonas espejiana
Pathway
pea00500  Starch and sucrose metabolism
pea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PESP_a1689
Enzymes [BR:pea01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PESP_a1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Asp_protease TPR_6
Motif
Other DBs
NCBI-ProteinID: ASM49769
UniProt: A0A221I7F4
LinkDB All DBs
Position
I:1629284..1631695
Genome map
AA seq 803 aa AA seqDB search
MKKYNLITASLLTLGLTACGAQNTSTDNENTAAQVKSAPGAPGVEPFWAYAGKTGIGTSY
EQYQKGQYSDSAATGDVSKVWFSIAKGMITETMFGLIHQAQIKDMQFVVTGKDFTVTEAD
ELDVTIDYLYKDAQGRPLSLAYIVTSTDKQGRFSLEKHIFTDPNGQTLFVRSVFNTELEG
LKAYVVVNPYLNNNGLGDFAKTTEQGLVAWEDDNYLSLQSATPFKAKTVGFTGESDGINA
LKTTQALNTQYTNTGETAGNVSMLAELGEISANTTFDLALSFGKTQQQSIQQGEQSLAKG
YQAVLDHYNGKGEALGWQDYLQSLKPLNTMVEQTADNGKLLYTSAMVLKAQEDKTNAGAL
IASLSNPWGETVSAKEGSTGYKAVWVRDFYQVAMAFMALGDTATAKTAFEYLEKVQVNSK
TPGNNGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLHKANVLSDEELKSWYSKML
KPAADFLVDGGLAKILWNDTQITPPATQQERWEEQEGYSPSTTAAIVAGLITASDIATLS
GDDKNAKRYLDTAIKYNNDIESHMFTTKGNLKGENSDGEYFIRIGQDTDANSDTKINANN
GREGFNKKQILDGGFLELVRYGVRGANDESIVKTLPEYDDETLEDNLQVKYSFSFDDGSG
TFAGYRRYGNDGYGEDEVTGTNYAEGGSNTPGQRGRVWPFFTGERGHYEIAAANANNALD
DAKQAQIKNSYIKGLEQFANNGMMLPEQVWDGVGVNKAGYKLGEGTNSATPLAWTHAEYV
KLVRSLSDKQVWDHYPVVEKALK
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataaccttataactgcctcactcttaacattgggtttaactgcctgtggt
gcacaaaacacaagcacagataatgaaaataccgctgcacaggttaaatcggcacctgga
gcacctggtgtagagccattttgggcttatgcaggtaaaacagggattggcacgtcttac
gagcaataccaaaaaggccaatacagtgattcagctgcaacaggcgatgtatctaaggtg
tggttttcaattgctaaaggcatgatcaccgaaaccatgtttgggcttatccaccaagcg
caaattaaagacatgcagtttgttgttacaggtaaagactttaccgtaaccgaagctgat
gaattagatgtcaccatagattacttatacaaagatgcgcaagggcgcccactttcgctt
gcctacatagtaacaagcactgataaacaagggcgctttagcctagaaaaacacatattt
accgacccaaatgggcaaacattatttgttcgcagtgtatttaacactgaacttgaagga
ttaaaagcctatgttgttgtaaacccttacctaaacaacaacgggttaggtgactttgct
aaaacgacagagcaaggccttgtcgcatgggaagacgataactatttatcacttcaatca
gcaaccccttttaaagctaaaacggtaggttttacaggtgaaagcgatggtattaacgca
cttaaaaccactcaagcgctaaacactcaatatacaaatactggcgaaactgcaggtaac
gtaagtatgttggcagagcttggtgaaataagcgctaacaccaccttcgatttagcactt
agttttggtaaaacgcagcagcaaagtatacaacaaggcgagcaaagcttagctaaaggc
tatcaagcagtgcttgatcactataacggtaaaggtgaagcactaggttggcaagattac
ctacaaagccttaaaccactaaatactatggttgagcaaactgccgataacggtaagctt
ttatacaccagcgctatggttttaaaagcacaagaagataaaaccaatgccggtgcgctt
attgcgtcattgtctaacccatggggcgaaaccgtatctgctaaagaaggctcaaccggt
tataaagcggtatgggtacgcgacttttaccaagtagccatggcatttatggcgctcggc
gatacagccactgcaaaaacagcattcgaataccttgaaaaagtacaagtaaacagcaaa
acaccgggtaataacggcgatacaggctggtttttacaaaaaacacatgtagatggtgag
cttgaatgggtaggtgtacaactagatcaaaccgctatgccaattatgcttgcttggaag
ttacataaagccaatgtacttagcgatgaagagctaaaaagttggtacagcaaaatgtta
aaacccgcggctgattttttagttgatggcggccttgctaaaattttatggaacgacacg
caaattacgccaccggctacccaacaagagcgttgggaagagcaagaaggttactcgcct
tcgactactgcggcaatagtggcaggccttattacagccagtgatattgcaacactaagt
ggcgatgataaaaacgcaaagcgctacttagatacggctataaagtacaacaacgatatt
gaatcgcacatgtttactactaaaggtaacttaaaaggcgaaaatagtgatggtgaatac
tttattcgtataggccaagataccgatgcaaactcagacactaaaattaacgctaataat
ggccgtgaagggtttaataaaaagcaaattttagatggcgggtttttagagctagtacgc
tatggtgtacgtggtgctaacgacgaaagcattgttaaaacactgcctgagtacgatgat
gaaacgctagaagataacctacaagttaaatacagctttagctttgacgatggcagcggc
acatttgcaggctaccgccgctacggtaatgacggctacggcgaagatgaagtaacagga
acaaattacgcagagggcggcagcaatacaccaggccaacgcggtcgtgtatggccgttt
ttcacaggtgagcgtggccactatgaaatagctgctgctaatgcaaacaacgcccttgat
gatgcaaaacaagcgcaaattaaaaacagctatataaaaggtttagagcaatttgccaat
aatggaatgatgctacctgagcaagtatgggatggcgtaggtgtaaataaagcaggttat
aagctaggtgagggcactaattcagcaacaccactggcatggacacatgctgagtatgtt
aaactggtccgttcattgagtgataaacaagtatgggatcattacccagttgtagagaaa
gccttaaagtag

DBGET integrated database retrieval system