KEGG   Pseudoalteromonas espejiana: PESP_a2645Help
Entry
PESP_a2645        CDS       T04989                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pea  Pseudoalteromonas espejiana
Pathway
pea00061  Fatty acid biosynthesis
pea00780  Biotin metabolism
pea01100  Metabolic pathways
pea01212  Fatty acid metabolism
Module
pea_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pea00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PESP_a2645 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PESP_a2645 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pea01004]
    PESP_a2645 (fabZ)
Enzymes [BR:pea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PESP_a2645 (fabZ)
Lipid biosynthesis proteins [BR:pea01004]
 Fatty acid synthase
  Component type
   PESP_a2645 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: ASM50583
UniProt: A0A221I9P5
LinkDB All DBs
Position
I:complement(2556012..2556464)
Genome map
AA seq 150 aa AA seqDB search
MANELNSLDIQEILSLLPHRYPMLLIDRVIDFTPGESLHAIKNVSINEPIFTGHFPNQPI
FPGVLILEAMAQATGLLGFKTVENRSDNELYLFAAVDNARFKQPVVPGDTMHLHVEFLKE
RRNIWKFAAEARVDGKVVCSAEIMCARREF
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaacgaattaaatagccttgatattcaagaaattttaagtttattaccacatcgt
tacccgatgctgttaattgatcgtgttattgactttacccctggcgagtcacttcatgcg
attaaaaatgtttctattaacgaacctatttttactggccattttcctaatcagccaatt
tttcctggtgtgctaatattagaagcaatggcgcaagccactggtttactaggttttaaa
acagtagaaaaccgtagcgataatgagctttacttatttgcagcggtagataacgcgcgt
tttaaacagccagtagtaccaggcgatacaatgcatttgcatgtagaatttttaaaagaa
cgccgcaatatatggaaatttgccgctgaagcaagagtcgacggcaaggttgtatgtagt
gccgaaattatgtgtgcgagaagagagttttaa

DBGET integrated database retrieval system