KEGG   Pseudoalteromonas espejiana: PESP_b0507Help
Entry
PESP_b0507        CDS       T04989                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pea  Pseudoalteromonas espejiana
Brite
KEGG Orthology (KO) [BR:pea00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PESP_b0507 (ahpF)
Enzymes [BR:pea01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PESP_b0507 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored NAD_binding_9 Thi4 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin Lycopene_cycl FMO-like Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ASM52056
LinkDB All DBs
Position
II:442624..444207
Genome map
AA seq 527 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSAEVESLANDLASLSDKFTVVTNPDTSA
RRPSMVVHSPVKNTHITFAGVPMGHEFTSLVLALLHTGGHASKAKSEDIEQIQSLDQELN
FEIYISLSCQTCPQVVQALNTMAATNSKIKATMIDGALFQEEVEERNILAVPAVYLNGEP
FSQGALSLTDILNKVDSKGAARQAAALSEKDEFDVLVVGGGPAGASAAIYSARKGLNTGI
VAERFGGQVADTLAIENFISVKATEGPKLVAQLEEHVKEYDVDVMHNQRAAGLERVNNKY
EITLENGATLKAKSLVLATGARWREMNVPGEQEYRGHGVAYCPHCDGPLFKGKPVAVIGG
GNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKANSLNNITIIKNAQTTEVLGDGKK
VTGLTYTDRVTGDSKALTLAGIFVQIGLIPNTEWLKISDLELSKFGEILVDAKGATSLPG
VYGAGDATNTPFKQIIIAMGSGATASLGAFDYLIRNSEESEQDKTAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaacattaaaaatcaattaaaaagccattttgaatcgcttactcaacct
gttgagctgcttattgccttggatgacagcaaaaaatcagcagaagttgaaagcttagca
aacgacttagcatcattaagcgataagtttacggtagttaccaaccctgataccagcgca
cgacgcccgtctatggttgtacattcaccggttaaaaacacccacattacgtttgcaggc
gtaccgatgggacacgaatttacaagtttagtgttggcgcttttacatactggcggacat
gcaagtaaagcaaaaagcgaagacattgaacaaatacaatcacttgatcaagaacttaat
tttgaaatctacattagcttgagttgccaaacgtgcccacaagtagtgcaggcgctaaac
acaatggctgcgactaatagcaaaattaaagcaacaatgattgacggcgcactatttcaa
gaggaagtagaagagcgcaacattttagcagtaccggctgtttatttaaatggcgaacca
tttagccaaggtgcattaagcctaactgacatattaaacaaagtagacagtaaaggtgca
gcacgccaagctgcggcacttagcgaaaaagacgaatttgacgtattagtagtaggtggc
ggacctgccggtgcatcagctgcaatttattctgcacgtaaagggttaaataccggtatt
gttgcagagcgatttggtgggcaagttgctgacacattagctattgaaaactttatatcg
gttaaagccactgaaggtcctaagcttgttgcacagcttgaagagcatgtgaaagagtac
gatgttgatgtaatgcataaccaacgtgctgcagggcttgaacgcgttaataacaaatac
gaaattacgcttgaaaacggggctactttaaaagctaaatcgctagttttagcaaccggt
gcacgctggcgcgaaatgaacgtacccggtgagcaagagtaccgcggacacggtgtagcg
tactgcccgcattgtgacggccccttatttaaaggtaagcctgtagctgtaattggcggt
ggtaactctggtattgaagccgcaatcgatttagcaaatattgttgagcacgtaacagtg
cttgagtttgcagatacactacgcgccgatgaagtacttattcgcaaagcaaacagctta
aataatattactattattaaaaacgcccaaactacagaagtacttggcgatggtaaaaaa
gtgacaggacttacttacacagaccgagtaacaggtgatagtaaggcacttactttagcg
ggtatttttgttcaaataggcttaatacctaacactgagtggttaaaaattagtgactta
gagttaagtaaatttggtgaaatattagttgatgcaaaaggtgctacgtcattacctggt
gtttatggcgcaggtgatgcaacaaataccccatttaagcaaattattattgccatgggc
agtggcgcaacagcaagtttaggtgcttttgattacttaattcgcaacagcgaagaaagc
gagcaagacaaaacagctgcttag

DBGET integrated database retrieval system