KEGG   Pseudoalteromonas espejiana: PESP_b0860Help
Entry
PESP_b0860        CDS       T04989                                 

Gene name
aroF
Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
pea  Pseudoalteromonas espejiana
Pathway
pea00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pea01100  Metabolic pathways
pea01110  Biosynthesis of secondary metabolites
pea01130  Biosynthesis of antibiotics
pea01230  Biosynthesis of amino acids
pea02024  Quorum sensing
Module
pea_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pea00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PESP_b0860 (aroF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PESP_b0860 (aroF)
Enzymes [BR:pea01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     PESP_b0860 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2 Tsi6
Motif
Other DBs
NCBI-ProteinID: ASM52362
UniProt: A0A221IF65
LinkDB All DBs
Position
II:complement(774041..775390)
Genome map
AA seq 449 aa AA seqDB search
MQSWNPNSWRELPILQQPQYPDQEELKSVEGQLKSAPPLVFAEETRSLFKQLEDVCEGRA
FLLQGGDCAESFSDFNAANIRDTFKTILQMAVVLTYGGKCPVVKIARMAGQYAKPRSADL
ETIDGVSLPSYRGDIVNSFEFTEEARIPDPQRLMKAYHNSAATLNLLRAFAQGGLADLHQ
VNRWNMGFVAANPQKERFQQLADKIQDALEFMEVCGINSTIAPSLKETDLYTSHEALLLG
YEEALTRRDHLSGDWYDCSAHFVWIGERTRQLDHAHIEFFKGIKNPIGVKVGPGMDPDDL
IRLIDAVNPDNIPGRLTLITRMGADVLPEKLPALVRRVQQEGRKVIWSSDPMHGNTEKAT
SGYKTRSFDNIMREISQFFAVHKSEGSYAGGVHLEMTGQHVTECTGGAYGLSDDDLAQRY
KTQCDPRLNADQVLEVGFLVADLLKDARK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgtggaacccaaatagctggagagaactgccaatactgcagcagccacagtac
ccagatcaagaagagttaaagtcagttgaaggccaattaaagagcgcaccgccattagtt
tttgctgaagaaacaagaagcttatttaaacagcttgaagatgtgtgcgaaggccgtgca
tttttacttcaaggtggtgattgtgctgagtcgtttagtgactttaacgcagctaatatt
cgcgatacgtttaaaaccattctacaaatggcggttgtattaacttacggcggtaaatgc
cctgtagttaaaattgcacgtatggctggccaatatgcaaaaccacgctctgcagattta
gaaacaattgacggagtttcattaccatcttaccgtggtgatattgtaaatagctttgaa
tttacagaagaagcacgcataccagaccctcaacgtttaatgaaggcttaccacaacagt
gcagctacattaaacttactacgtgcatttgcacaaggtggcttagctgacttacaccag
gtaaaccgctggaatatgggttttgttgccgctaatccgcaaaaagagcgattccaacaa
cttgcagacaaaattcaagatgcacttgaatttatggaagtgtgtggcattaattctaca
attgcacctagccttaaagaaacagatttatatacttctcacgaagccttattactaggc
tacgaagaagcgctaacacgccgtgaccacctttcaggtgattggtacgactgttcagca
cactttgtttggattggtgagcgcacacgccaactagatcatgcccacattgagtttttc
aaaggtattaaaaacccaataggtgttaaggttggccctggcatggacccagacgaccta
attcgtttaattgatgcagtgaacccagataacatcccgggtcgcttaacgttaattaca
cgtatgggtgccgatgttcttccagagaaactaccagcactcgttcgccgcgttcaacaa
gaaggccgtaaagtaatttggagctcagatccaatgcacggcaatactgaaaaagcgaca
tctggttacaaaacacgtagctttgataatattatgcgcgagatcagccaattctttgca
gtacacaaatctgaaggttcatacgcaggtggtgttcacttagaaatgacaggtcagcac
gtaacagagtgtacaggtggtgcttacggtttatcagacgatgacctagcacagcgttac
aaaacacaatgtgaccctcgcttaaatgcagaccaagtattagaagttggtttcttagta
gctgatttattaaaagacgctcgtaaataa

DBGET integrated database retrieval system