KEGG   Pectobacterium parmentieri SCC3193: W5S_0213Help
Entry
W5S_0213          CDS       T02514                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pec  Pectobacterium parmentieri SCC3193
Brite
KEGG Orthology (KO) [BR:pec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pec03012]
    W5S_0213
   03029 Mitochondrial biogenesis [BR:pec03029]
    W5S_0213
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pec04147]
    W5S_0213
Translation factors [BR:pec03012]
 Eukaryotic Type
  Elongation factors
   W5S_0213
 Prokaryotic Type
   W5S_0213
Mitochondrial biogenesis [BR:pec03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    W5S_0213
Exosome [BR:pec04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   W5S_0213
  Exosomal proteins of breast cancer cells
   W5S_0213
  Exosomal proteins of colorectal cancer cells
   W5S_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: AFI88344
UniProt: A0A0H3HYC9
LinkDB All DBs
Position
238162..239346
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEAKIVELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggtaacgcacgtgcattcgaccagatcgataacgcaccagaagaaaaagcacgtggt
atcaccatcaacacgtctcacgttgaatacgataccccgtctcgccactacgcgcacgtt
gactgcccaggacacgccgactatgtgaaaaacatgatcaccggtgctgcccagatggat
ggcgcgatcctggttgttgctgcaactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagaactgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccaggcgatgacacgccggtaattcgtggttcagcgctgaaagcgctggaa
ggcgaagctgagtgggaagctaaaatcgtcgaactggcaggctacctggattcttatatt
ccagaaccagagcgtgcaattgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtactgttgttaccggtcgtgtagagcgcggtatcgttaaagtcggt
gaagaagttgaaatcgttggtatcaaagatacggcgaaatcgacctgtactggcgtagaa
atgttccgcaaattgctggacgaaggtcgtgcaggggagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagaaatcgagcgtggccaggtactggctaagccgggttcaatcaag
ccgcacacccagtttgaatcagaagtgtatatcctgagcaaagatgaaggcggtcgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgacgtaacgggt
accatcgaactgccagaaggcgtagagatggtcatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccaatcgcaatggacgacggtttgcgtttcgcaatccgtgaaggc
ggccgtactgtaggtgcgggtgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system