KEGG   Pectobacterium parmentieri SCC3193: W5S_1499
Entry
W5S_1499          CDS       T02514                                 

Definition
(GenBank) putative type III effector Hop protein
Organism
pec  Pectobacterium parmentieri SCC3193
SSDB
Motif
Pfam: Plasmid_RAQPRD Sfi1
Other DBs
NCBI-ProteinID: AFI89593
UniProt: A0A0H3I4H6
LinkDB
Position
complement(1642765..1643145)
AA seq 126 aa
MVRPTRLRAAHYSALIFLSAALMLVSPLTAHADTPSQRQELAAALRQLDALEHFVVQSAS
RTSTAPGERYHFDYPRLLDDLAHVRAGIQFHLSPSRAQPRDTTELSSHYRQESVSERSNV
SPEGQP
NT seq 381 nt   +upstreamnt  +downstreamnt
atggtgcgtcccacccgacttcgcgctgcgcactacagcgcgctcatttttctctccgcc
gctctgatgctggtcagtccattgactgcccatgcagacacaccatctcagcgtcaagaa
ctggcggccgcactgcgtcagctcgacgcactggagcacttcgttgtgcaaagcgcatcc
agaacctccactgcaccaggcgaacgctatcacttcgactacccccgactgctcgatgat
ttagcgcatgtacgcgcaggcattcagttccatctgtcgccgtcccgcgcccagccgcgc
gacaccaccgagctgagcagtcactaccgtcaggaatcggtatccgagcgcagcaacgtc
tccccagaaggccagccatga

DBGET integrated database retrieval system