KEGG   Pectobacterium parmentieri SCC3193: W5S_2615Help
Entry
W5S_2615          CDS       T02514                                 

Definition
(GenBank) Xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec00040  Pentose and glucuronate interconversions
pec00051  Fructose and mannose metabolism
pec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    W5S_2615
   00051 Fructose and mannose metabolism
    W5S_2615
Enzymes [BR:pec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     W5S_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFI90703
UniProt: A0A0H3I3T0
LinkDB All DBs
Position
complement(2829854..2830852)
Genome map
AA seq 332 aa AA seqDB search
MATYTYPEFGAGLWHFANYIDRYAVDGYGPALSTIDQIKAAKEVGELSYVDLPYPFTPGV
TLSEVKDALKDAGLKAIGITPEIYLQKWSRGAFTNPDPAARAAAFELMHESAGIVRELGA
NYVKVWPGQDGWDYPFQVSHKNLWKLAVDGMRDLAGANPDVKFAIEYKPREPRVKMTWDS
AARTLLGIEDIGLDNVGVLLDFGHALYGGESPADSAQLIIDRGRLFGMDVNDNLRGWDDD
LVVGTVHMTEIFEFFYVLKINNWQGVWQLDQFPFRENHVEAAQLSIRFLKHIYRALDKLD
IPALQAAQEAQNPLQAQRIVQDALLSSINVSE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtatacctaccctgaatttggtgccggtttgtggcattttgcgaattatatt
gaccgctacgcggtggacggctacggcccggctttgagtacgatcgatcagatcaaagca
gcaaaagaggtcggagagctttcctacgtcgatctgccttatcccttcacgccgggcgtc
acactcagcgaagtgaaggatgcgctgaaggatgcgggtctgaaagcgattggcatcaca
ccggaaatttacctgcaaaagtggtcgcgtggcgctttcaccaatcccgatccggccgcg
cgggctgcggcgtttgaactgatgcatgaatctgctggcattgtgcgtgaactgggagcg
aattacgtcaaagtctggccggggcaggatggctgggattatccattccaggtcagccat
aaaaacctgtggaagctggcggttgatggtatgcgcgatctcgctggcgctaacccggat
gtgaaattcgccatcgaatacaagccgcgtgaaccgcgtgtgaaaatgacctgggattcc
gcagcgcgaacgctgctggggattgaagatatcgggttagataacgttggcgtgctactg
gacttcggccatgcgctgtatggcggtgaatcaccagcggattctgcccagttgattatc
gatcgcggtcggctgttcggcatggatgtgaatgacaatctgcgcggttgggatgatgat
ttggtggtcggtacggtgcacatgaccgagattttcgagtttttctacgtgctgaaaatc
aacaattggcagggcgtgtggcagctcgatcagttcccgttccgtgagaatcacgtcgag
gcggcgcaactgtctattcgtttcttgaagcatatctatcgtgcgctggataaactggat
attccggcgcttcaggcggcacaggaagcgcaaaacccgttacaggctcagcggattgta
caggacgcgctgctgtcatccattaacgttagcgagtag

DBGET integrated database retrieval system