KEGG   Pectobacterium parmentieri SCC3193: W5S_4072Help
Entry
W5S_4072          CDS       T02514                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pec  Pectobacterium parmentieri SCC3193
Brite
KEGG Orthology (KO) [BR:pec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    W5S_4072
Enzymes [BR:pec01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     W5S_4072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin FAD_binding_3 NAD_binding_8 Thi4 DAO K_oxygenase Lycopene_cycl AlaDh_PNT_C Thioredoxin_4 DSBA FMO-like
Motif
Other DBs
NCBI-ProteinID: AFI92135
UniProt: A0A0H3I834
LinkDB All DBs
Position
complement(4405392..4406954)
Genome map
AA seq 520 aa AA seqDB search
MLDNTMKVQLKAYLEKLTKPVELMATLDDSAKSAEVRTLLTDIAELSDQVNFIEKNDLSV
RKPSFLITNPGSQSGPRFAGAPMGHEFTSLILALLQVGGHPSKEAKELLDQIRNLNGSFH
FETYYSLSCHNCPDVVQALNLMAVLNPKITHTAIDGGVFQDEIQNRNVMGVPTIFLNGEH
FSQGRTSLAEIVAKIDTGAGAKQVEKLNQRDVYDVLIIGSGPAGAAAAVYSARKGIRTGL
VGERFGGQVLDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSAEALIPGGEPG
KPHQVITVSGATLKARSVIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQEKVRSLPNVDIILNAQTTEVKGD
GQKVTGLSYKDRVTDTVQDLPLEGIFVQIGLLPNTHWLEGTVARNRIGEIEIDAKCETSV
KGIFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTRA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaatacgatgaaagtccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttaatggcgactctagatgattccgctaaatctgcggaagtcagaaccttgctg
accgatattgccgagttgtccgatcaggtcaactttattgaaaagaatgatctatccgtc
cgtaagccttcgtttctgattactaaccccggttcccaaagcggcccacgttttgccggt
gcgccgatggggcacgaatttacctccctgattctggcgttattgcaggtgggtggacat
ccgtcgaaagaagcaaaagaattactcgatcaaatccgcaatcttaacggttcgttccac
tttgaaacgtattactcgctgtcctgccacaactgcccggacgtggtgcaggcgctgaat
ttaatggcggtgttgaatccgaagatcacccataccgcgatagacggcggcgtgtttcag
gatgagatccaaaaccgtaatgtcatgggtgttcccaccattttcctgaacggcgaacat
ttcagccaggggcggacgagtcttgcggagattgtggctaaaatcgataccggtgcaggc
gctaaacaggttgagaagctgaaccagcgtgacgtctatgatgtgttaatcatcggcagc
ggcccggcaggggcggcagcggcagtctattcggcgcgtaaaggcatccgtaccggtttg
gtcggtgaacgctttggcggtcaggtgctggataccgttgatatcgaaaactacatttct
gtgccgaaaacggaaggtgccaaactggcgaccgcactgaagagccatgttgatgactat
gatgttgatgtgatcgacgcgcagagtgcagaagctttaattcctggcggagagccgggt
aaaccgcatcaggtgattaccgtatccggcgcgacgctgaaagcgcggagtgtgatcatt
gcgacaggcgcgcgttggagaaacatgaatgtgccgggtgaagatcagtaccggacgcgc
ggggtaacgtactgcccacactgtgatggtccgctgtttaaaggtaagcacgttgcggtg
attggcggtggaaactccggcgtagaagcggctatcgatctggctggtgtggtgaaacac
gtcacgctgcttgagtttgcaccggagctgaaagcggattcggtattgcaggagaaggta
cgcagcctgccgaacgtcgatatcattctgaatgcgcaaaccacagaagtgaagggcgat
gggcagaaggtgacgggactgagctacaaagatcgtgttaccgatacggtgcaggattta
cccctggaagggatcttcgtgcagattggtttgttgcctaacacccactggttagaaggc
acggttgccagaaaccgcattggtgaaatagagatcgatgccaagtgtgaaactagcgtg
aaagggatctttgctgctggcgactgtacgacggtgccgtacaaacagatcattatcgcg
acgggggaaggagcaaaagcgtccttgagtgcttttgattacctgatcagaacacgggcg
taa

DBGET integrated database retrieval system