KEGG   Pectobacterium parmentieri SCC3193: W5S_4288Help
Entry
W5S_4288          CDS       T02514                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pec  Pectobacterium parmentieri SCC3193
Pathway
pec00564  Glycerophospholipid metabolism
pec01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pec00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    W5S_4288
Enzymes [BR:pec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     W5S_4288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N FAD_binding_3 PAP_PilO FAD_oxidored GIDA HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFI92344
UniProt: A0A0H3IBC0
LinkDB All DBs
Position
4622711..4624213
Genome map
AA seq 500 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALSERETLLKMAPHIIFPMRFRLPHQPHLRPAWMIRIGLFMYDNIGKRVSLPAS
KGLKFGADSVLKPELKQGFEYSDCWVDDARLVVLNAQEVTKRGGEVRTRTKVTRARREQG
VWIVDAVDSLTGETFTWRAKGLVNATGPWVKEFFDDGLQLKSPYGIRLIKGSHIVVPKVH
NQPQAYILQNKDHRIVFVIPWQDDYSIIGTTDVEYKGNPHDVKIDDNEVGYLLDVYNDHF
KQQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVDDDNGQAPLLSVFGGKLTTYRK
LAEHALDKLHKYYPQAGKAWTKGAVLPGGDIAGTRDDYAAALRRRFNLPESLTRRYSRTY
GSNSELILANVKSLSDMGEDFGHDLYEVELRYLIEKEWAVTLDDVIWRRTKLGMRFDDAQ
KQRISDWLASHRQQQMAKAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctcatcgttatcggcggcggaattaacggtgcaggcatcgccgca
gatgcggctgggcggggtttatcagtcctgttgttggaagcgcaggatctcgcctgtgcc
acgtcctccgccagctccaagctgattcacggtggcctgcgttaccttgagcactatgag
tttcgtttggtcagcgaagcgctgtctgagcgtgaaacgctgctgaaaatggcaccgcac
attattttcccgatgcgctttcgtttgccccatcagccacacctgcgtccggcctggatg
attcgtatcggcctgttcatgtatgacaacattggcaaacgcgttagcctgcctgccagt
aagggactgaaattcggcgcagattcggttcttaaacctgaactgaagcaaggctttgaa
tattcggactgctgggtggacgatgcgcgtctggtggtgttaaacgcgcaggaagtgaca
aaacgtggtggagaagtccgtacccgtaccaaagttacccgcgctcgccgtgaacaaggc
gtgtggattgtggatgccgttgattcactgaccggcgaaacctttacctggcgcgccaaa
ggtttagtaaacgcaaccggcccgtgggtgaaggaattctttgatgacggcctgcaactg
aaatcgccttacggcatccgtttgatcaaaggcagccacatcgtggtgccaaaagttcat
aaccagccgcaagcgtatatcctgcaaaacaaagatcaccgtattgtgttcgtgatcccg
tggcaagacgattattcgatcatcggcaccactgacgtggaatacaaaggtaatccgcac
gatgtgaagatcgatgacaacgaagtcggttatctgctggatgtgtataacgaccacttc
aaacagcaactcacgcgtgacgatatcgtctggacatattccggcgtgcgtccgctgtgt
gatgacgaatctgattctccacaggcgattacgcgtgattacaccctgtcagtggatgat
gacaacggtcaggctccgttgctttccgtgtttggcggcaagctgacgacataccgtaag
ctagcagagcacgcgctggacaagttgcacaaatactatccgcaggcaggcaaagcctgg
acaaaaggtgcggtactgccgggtggtgatatcgctggcacacgtgatgactacgctgct
gcgctgcgtcgccgtttcaatctgcctgaatcactaacgcgccgttacagccgtacctat
ggttcaaacagcgaactcattctggcaaacgtgaaaagcctcagcgatatgggtgaagat
ttcggtcatgacctgtatgaagtggaactgcgctatctgatcgagaaagaatgggctgtc
acgctggacgacgtcatctggcgtcgcaccaaactgggcatgcgctttgatgatgcacag
aaacagcgcatcagcgactggttagccagccaccgccaacagcagatggcaaaagcgggt
taa

DBGET integrated database retrieval system