KEGG   Pseudonocardia sp EC080619-01: AD017_05675Help
Entry
AD017_05675       CDS       T04234                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
pecq  Pseudonocardia sp EC080619-01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DUF3509 LZ_Tnp_IS481
Motif
Other DBs
NCBI-ProteinID: ALL80822
UniProt: A0A0P0S9S3
LinkDB All DBs
Position
1232492..1233562
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVKPMLAKPASSIPDGRLYEPKWDGFRSIVFRDGDDVEIGSRNERPMTRYFPE
VVEAVRANFPDRAVIDGEIVVADPANNRLDFEALQQRIHPAASRVTLLSTETPASFVAFD
LLALGADDLTGLPFAERRDLLESALADAAPPVHLTPVTDDTGTARRWFDRFEGAGLDGLI
AKDPAGTYQPDKRVMTKIKHERTADCVVAGYRVHKSGPDAVGSLLLGLHDERGVLVSVGV
VGAFPMARRRELMTELQPLVTGFDEHPWAWAKQLEGERTPRKSETSRWNAGKDLSFVPLR
PERVVEVRYDYMEGARFRHTTQFVRWRPDRAPESCTYEQLDRPVGFDLAEVLAGRG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgcccgtgatgcccccggtgaagccgatgctcgccaagcccgcgtcgtcgatc
cccgacggccggctgtacgagcccaagtgggacggcttccgctcgatcgtcttccgggac
ggtgacgacgtcgagatcggctcccgcaacgagcggccgatgacgcgctacttccccgag
gtcgtcgaggcggtgcgggcgaacttcccggaccgcgcggtgatcgacggcgagatcgtc
gtcgcggaccccgcgaacaaccgcctcgacttcgaggcgctccagcagcggatccatccc
gccgcgagccgggtgacgctcctgtcgaccgagacgccggcgtcgttcgtggcgttcgac
ctgctcgcgctcggcgccgacgacctgaccgggctgccgttcgccgagcgtcgcgacctg
ctggagtccgcgctcgccgacgccgccccgccggtgcacctcacccccgtcaccgacgac
accggcaccgcccggcgctggttcgaccggttcgagggcgccgggctcgacggcctgatc
gcgaaggacccggcggggacctaccagccggacaagcgcgtcatgaccaagatcaagcac
gaacggaccgcggactgcgtcgtcgccgggtaccgggtgcacaagtccgggccggacgcc
gtcgggtcgctcctgctcggcctgcacgacgagcgcggggtgctggtgtcggtcggtgtc
gtcggcgcgttcccgatggcacgcagacgggagctgatgaccgagctccagccgctggtc
accggcttcgacgagcacccgtgggcctgggcgaagcagctcgagggcgagcgcaccccg
cgcaagtccgagacgagccgctggaacgccggcaaggacctctcgttcgtgccgctgcgc
ccggagcgggtcgtggaggtgcgctacgactacatggagggcgcccggttccggcacacc
acccagttcgtgcggtggcgcccggaccgcgccccggagtcgtgcacctacgaacagctg
gaccggccggtcgggttcgacctggccgaggtcctcgcgggccgcggctga

DBGET integrated database retrieval system