KEGG   Pseudonocardia sp EC080619-01: AD017_11835Help
Entry
AD017_11835       CDS       T04234                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pecq  Pseudonocardia sp EC080619-01
Pathway
pecq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pecq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AD017_11835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pecq03400]
    AD017_11835
Enzymes [BR:pecq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AD017_11835
DNA repair and recombination proteins [BR:pecq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AD017_11835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ALL81715
UniProt: A0A0P0SC28
LinkDB All DBs
Position
complement(2528407..2529345)
Genome map
AA seq 312 aa AA seqDB search
MLPMLATPGPLPTGPGWSFEVKWDGMRVLASVTEGDDGRALVLRTRSGRDVTANFPELAE
LAGAAPDVVLDGEVVLLDAGVPSFAALAHRMQGVVGAAAAERRPVTFMVFDVLRLYGVSL
LDRPLSERRATLERLDLGALAHVEASPLYPDGASLLAVTAERGLEGVVAKKESSVYRPGR
RSPDWVKVAHRHSQSCVVGGRRPEKGSGSRIGALLLGVSGPDGLEFAGRVGSGLAGDAVQ
QLLTERLGPLTAESSPFAQTLPRLDAAGATWCTPRVVVEVAHLGWTAAGRLRQPVFRGIR
DDVDPTGVQREP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcccatgctcgccacccccggaccgctcccgaccggtcccggctggtcgttcgag
gtcaagtgggacggcatgcgcgtgctggcatcggtcaccgagggtgacgacggccgggca
ctcgtcctgcgtacccgttccggccgggacgtcacggcgaacttcccggaactcgccgag
ctcgccggtgcggcccccgacgtcgtgctcgacggggaggtcgtcctgctcgacgccggc
gtccccagcttcgccgcgctcgcccaccgcatgcagggcgtcgtcggcgccgccgccgcg
gagcgccgccccgtcaccttcatggtgttcgacgttctgcggctctacggggtgtcgctc
ctcgaccggccgctgtccgaacggcgggccacgctggagcggctcgacctgggcgcgctc
gcgcacgtggaggcgtcgccgctgtacccggacggggcgtcgttgctggcggtgaccgcc
gagcgcgggctggagggcgttgtcgcgaagaaggagtcgtcggtgtaccggccgggccgg
cgcagcccggactgggtgaaggtcgcgcaccggcactcgcagagctgcgtggtcggcggg
cggcgcccggagaaggggagcggcagccggatcggggcactgctgctcggcgtctccggc
ccggacgggctggagttcgccgggcgggtcgggtccggtctcgccggtgacgcggtgcaa
cagctcctcaccgagcggctcggcccgctgacggcggagtcgtcaccgttcgcgcagacc
ctgccccggctcgacgcggccggggccacctggtgcacgccacgcgtcgtcgtggaggtc
gcgcacctcggctggacggcggccggccggctgcgccagccggtgttccgggggatccgc
gacgacgtcgaccccaccggggtgcaacgggagccgtga

DBGET integrated database retrieval system