KEGG   Pseudonocardia sp EC080619-01: AD017_14750Help
Entry
AD017_14750       CDS       T04234                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pecq  Pseudonocardia sp EC080619-01
Pathway
pecq00620  Pyruvate metabolism
pecq00680  Methane metabolism
pecq00710  Carbon fixation in photosynthetic organisms
pecq01100  Metabolic pathways
pecq01120  Microbial metabolism in diverse environments
pecq01200  Carbon metabolism
Module
pecq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pecq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AD017_14750
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AD017_14750
   00680 Methane metabolism
    AD017_14750
Enzymes [BR:pecq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AD017_14750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALL84658
UniProt: A0A0P0SJC8
LinkDB All DBs
Position
complement(3132380..3135091)
Genome map
AA seq 903 aa AA seqDB search
MSESEHQALRADIRRLSTLLGQTLSDEAGPEVLELVERVRHAARDSARGEAGPDVVAALL
DGIDTGTAVLLARAFSQYFQLTNVAEQLHRSRELRALRPADARPLRTVLRRLASEADPDE
VAEVLARTQLRPVFTAHPTESTRQSVLGILRRVVDALERGAPDPELAALVDLLWQTDDIR
PGKPMVIDEARNIAWFAARLGERTVPDLLDEFAHEAAEAGLEIPDDTRPLVLGSWVGGDR
DGNPNVTPAVTREVLELNADRALRIHAKLVEQLVFELSVSTRVMGVSEELRGSLTRDRRA
LPDVHDRFIRLNAHEPYRLKLSYVAARLENTRRRIAARGPHEPGVDYLGSAGYLDDLLVV
DRSLRGHHGARIAGGTLARAIRSARALGLHLVELDVREHSQKHHDALGAIYDELGELEKP
YAELTRDERRELLSAELRRKRPLVRRHYGVPEATAPVLDTFDTVHALQHEFGPDVVRTYI
VSMARDVDDLLAVAVLARESYMVEIGGENPRSSIDLVPLFETVDELSKAGELLEGLLADP
GYRQQVRNRGDLQEIMLGYSDSNKGAGITASQWQIHRAQRQLRDVAAEHGVRLRLFHGRG
GSVGRGGGPAGEAIASAPFGSVDATMKLTEQGEVISDKYSLPSLAHDNLEILLASMLDAT
LLHQASRWPADVLARWDEVMECVSTAATETYLRLVGDDGLPVFFTAATPVEELGRLNVGS
RPSKRPGQGTPTLDDLRAIPWVFGWTQTRMVVPGWYGLGSGLRAAREAGYAEDLAEMRQW
AFFRNLIGNVEMTLAKTDLRIASNYVATLVEPEQQGLFSQIRAEHELTCRELLAVTGESQ
LLARHPVLRNTLSVRNAYLEPLHHLQVELLAQRRAAGDEPDPDLERALLLTINGIAAGMK
NTG
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagtccgagcaccaggcgctgcgcgcggacatccggcggctctccacgctgctc
gggcagacgctgtccgacgaggccggcccggaggtcctggagctggtcgagcgggtgcgc
cacgcggcccgcgactccgcccgcggggaggcgggaccggacgtcgtcgccgccctgctc
gacggcatcgacaccgggaccgcggtgctgctggcccgggcgttctcccagtacttccag
ctgaccaacgtcgccgagcagctgcaccgctcccgcgagctgcgtgcgctgcgccccgcc
gacgcccgcccactgcgcaccgtgctgcgcaggctcgcgtccgaggcggacccggacgag
gtcgccgaggtcctcgcccgcacccagctgcgcccggtcttcaccgcccaccccaccgag
tccacccggcagtccgtgctggggatcctgcgccgggtcgtggacgccctcgaacgcggg
gcccccgatcccgagctcgccgcgctggtggacctgctgtggcagaccgacgacatccgc
ccgggcaagccgatggtgatcgacgaggcccgcaacatcgcctggttcgccgcccggctc
ggcgagcgcacggtccccgacctgctggacgagttcgcccacgaggccgccgaggcgggc
ctggagatccccgacgacacccggccgctcgtgctgggctcctgggtcggcggcgaccgc
gacggcaacccgaacgtcacccccgccgtgacgcgcgaggtgctcgagctgaacgccgac
cgggcgctgcgcatccacgcgaagctcgtcgagcagctggtcttcgagctgtcggtgtcc
acccgggtcatgggcgtctccgaggagctgcgcggctcgctcacccgtgaccggcgcgcc
ctgccggacgtccacgaccggttcatccgcctcaacgcgcacgagccgtaccgcctgaag
ctgtcctacgtggcggcccggctggagaacacccgccgccggatcgccgcccgcggcccg
cacgagccgggcgtcgactacctgggcagcgccggctacctggacgacctgctcgtcgtc
gaccggtcgctgcgcggccaccacggcgcacggatcgccggcggcaccctggcccgggcg
atccgctcggcccgggcgctcggcctgcacctggtcgagctggacgtgcgggagcactcg
cagaagcaccacgacgccctcggcgcgatctacgacgagctcggcgagctggagaagccc
tacgccgagctgacccgcgacgagcgccgcgaactgctgtcggcggagctgcgccgcaag
cgtccgctggtccggcggcactacggcgtccccgaggcgaccgccccggtgctcgacacc
ttcgacaccgtgcacgcgctgcagcacgagttcgggccggacgtcgtgcggacctacatc
gtgtcgatggcccgcgacgtcgacgacctgctcgccgtcgccgtcctggcccgcgagtcg
tacatggtggagatcgggggcgagaacccccggtcgtcgatcgacctggtcccgctgttc
gagacggtcgacgagctgtcgaaggcgggcgagctgctggagggcctgctcgccgacccc
ggctaccggcagcaggtccgcaaccgcggtgacctgcaggagatcatgctcggctactcc
gactccaacaagggagccgggatcaccgcgtcgcagtggcagatccaccgggcccagcgc
cagctgcgcgacgtcgccgcggagcacggcgtccggctgcggctgttccacggccgcggc
ggctcggtcggccgcggtggcgggcccgccggggaggcgatcgcgtcggcgccgttcggg
tcggtggacgcgacgatgaagctcaccgagcagggcgaggtcatctccgacaagtactcg
ctgccgagcctggcgcacgacaacctggagatcctgctcgcgtccatgctggacgcgacg
ctgctgcaccaggcgtcgcgctggcccgccgacgtcctggcgcggtgggacgaggtgatg
gagtgcgtgtccaccgccgccaccgagacctacctgcggctggtcggcgacgacggcctc
ccggtcttcttcaccgccgccaccccggtggaggagctgggcaggctcaacgtcgggtcg
cggccgtcgaagcggcccgggcagggcacccccaccctggacgacctgcgcgcgatcccg
tgggtgttcggctggacgcagacccggatggtcgtgccgggctggtacgggctgggctcc
ggcctgcgcgccgcgcgggaggccggctacgccgaggacctcgccgagatgcggcagtgg
gcgttcttccggaacctgatcggcaacgtcgagatgacactggcgaagaccgacctgcgg
atcgcgtccaactacgtcgcgaccctcgtcgagccggagcagcagggcctgttctcccag
atccgcgccgagcacgagctgacctgccgggagctcctcgcggtgacgggcgagtcgcag
ctgctggcccggcacccggtgctgcgcaacacgctgtcggtgcgcaacgcctacctggag
ccgctgcaccacctgcaggtggagctgctggcacagcgccgggccgcgggcgacgaaccg
gacccggacctggagcgcgccctgctgctgacgatcaacggcatcgcggccgggatgaag
aacaccgggtga

DBGET integrated database retrieval system