KEGG   Pseudonocardia sp EC080619-01: AD017_14755Help
Entry
AD017_14755       CDS       T04234                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
pecq  Pseudonocardia sp EC080619-01
Pathway
pecq00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pecq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AD017_14755
Enzymes [BR:pecq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AD017_14755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M DUF4434 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: ALL82126
UniProt: A0A0P0SD70
LinkDB All DBs
Position
3135406..3137427
Genome map
AA seq 673 aa AA seqDB search
MARWLRRTPGVTRPRTEFGADYNPEQWPRETWGSDIALMREAGVTVATVGVFSWARLQPA
PDRWDFGWLDEVLDLLGDGGIAVDLATATASPPPWLHHRHPEILPVDADGRTVWPGGRQH
YRPTSPVFRRYALDLVRRMADRYGGHPALAAWHVSNELGCHNVHDHSSDAETAFRSWLRE
RYGDLDALNHAWGTSFWSQHYGDWAEIRTPRTVGPGTFPNPTQLLDFARFSSDALRDHLR
AEVAVLREVTPDVPVTTNFMVMGETSGMDYASWVPEIDIVSNDHYVVPGPDARDELSFSS
NLTGNLAGGEPWWQMEHSTSAVNWQPVNRAKRPGELARDSLTHLAHGADAICYFQWRQST
AGAEKFHSAMVPHAGPDSAVFRDVTALGATLAELAPVAGAHRVPARAAILWDQPSWWAAE
QPFTPTTELRYKAEALGWYRAFLDAGVRADVVPAGAGLAGYELVVAPVLHVVGPDRAAEL
AAFVDGGGHLVTTYFSGTVDESAHAVPGGYPGALRDLLGVRVEEFAPLDPGATVLLDDGG
TGDLWSEPVQVVDPSVEVLARYTGAGTDPGAPDLAGLPAVTRRPAGRGSASYVSTRLADR
APLLGRLLRRAGIVPELPGELCGRVELVRREGFRFLVNRGDTPVDLTPLGEAETLAGLPP
TVLPPRGATVLRD
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctggctgcgccgcacacccggcgtcacccgtccccggaccgagttcggggcc
gactacaaccccgagcagtggccgcgggagacctgggggtccgacatcgccctcatgcgc
gaggccggggtgacggtcgcgaccgtcggcgtcttctcctgggcccggttgcagcccgcg
ccggaccggtgggacttcggctggctcgacgaggtgctcgacctgctgggcgacggcggg
atcgcggtcgacctggcgaccgcaacggcgtccccgccgccgtggctgcaccaccggcac
cccgagatcctcccggtcgacgccgacggccggaccgtgtggccgggcggacgccagcac
taccggcccacgtcgccggtgttccgccggtacgccctcgacctggtccggcggatggcc
gaccgctacggcggacacccggcgctggccgcgtggcacgtgtccaacgagctgggctgc
cacaacgtccacgaccactcgtccgacgccgagaccgccttccggtcctggctgcgcgag
cgctacggcgacctggacgcgctcaaccacgcctggggcacctcgttctggtcccagcac
tacggcgactgggccgagatccgcaccccgcgcaccgtcgggcccgggacgttcccgaac
cccacccagctcctcgacttcgcccgcttctcctccgacgcgctgcgcgaccacctgcgg
gccgaggtggcggtgctgcgggaggtgaccccggacgtccccgtcaccacgaacttcatg
gtgatgggcgagaccagcgggatggactacgcgagctgggtcccggagatcgacatcgtg
tccaacgaccactacgtcgtcccggggccggacgcccgcgacgagctgtcgttctcgtcg
aacctcaccggcaacctggccggcggggagccgtggtggcagatggagcactcgacgtcg
gcggtgaactggcagccggtgaaccgggccaagcggcccggcgagctcgcccgggactcc
ctcacccacctcgcgcacggggccgacgcgatctgctacttccagtggcgccagtccacg
gcgggtgccgagaagttccactcggcgatggtcccgcacgccgggccggactccgcggtg
ttccgcgacgtcacggccctgggcgcgaccctcgcggagctcgccccggtcgccggggcc
caccgggtgcccgcccgggcggcgatcctgtgggaccagccgtcgtggtgggccgccgag
cagcccttcaccccgacgacggagctgcgctacaaggccgaggcgctcggctggtaccgg
gcgttcctcgacgccggggtgcgcgccgacgtcgtccccgccggggccgggctcgccggg
tacgagctcgtcgtcgcgccggtgctgcacgtcgtcgggccggaccgggcggccgagctc
gccgcgttcgtcgacggcggcgggcacctggtcaccacctacttctccggcaccgtcgac
gagtcggcgcacgccgtgccgggcgggtaccccggtgcgctgcgcgacctgctgggcgtc
cgggtcgaggagttcgccccgctcgacccgggcgccacggtcctgctcgacgacggcggc
accggcgacctgtggagcgagccggtgcaggtcgtcgacccgtcggtggaggtgctcgcc
cgctacaccggcgcgggcaccgacccgggtgcgccggacctggccgggctgcccgcggtg
acccggcgcccggccggacggggctcggcgagctacgtctcgacccggctcgccgaccgc
gccccgctgctcggacggctgctgcgccgggccgggatcgtgccggagctgccgggggag
ctgtgcggccgggtggagctggtccgccgcgagggcttccggttcctggtgaaccggggc
gacacccccgtcgacctgaccccgctcggagaggccgagaccctggccggcctgccgccg
accgtgctgcccccacgcggggcgacggtcctgcgcgactga

DBGET integrated database retrieval system