KEGG   Pseudonocardia sp EC080619-01: AD017_19320Help
Entry
AD017_19320       CDS       T04234                                 

Definition
(GenBank) 2-methyl-1,2 propanediol dehydrogenase
  KO
K20927  2-methyl-1,2-propanediol dehydrogenase [EC:1.1.1.400]
Organism
pecq  Pseudonocardia sp EC080619-01
Brite
KEGG Orthology (KO) [BR:pecq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AD017_19320
Enzymes [BR:pecq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.400  2-methyl-1,2-propanediol dehydrogenase
     AD017_19320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C FAD_binding_2 GMC_oxred_N DAO FAD_binding_3 Pyr_redox_2 Lycopene_cycl Thi4 NAD_binding_8 FAD_oxidored Pyr_redox_3 GIDA 3HCDH_N HI0933_like MIP Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ALL82797
UniProt: A0A0P0SF50
LinkDB All DBs
Position
4122748..4124400
Genome map
AA seq 550 aa AA seqDB search
MTGYEETDVLVIGAGPGGAGIALKLAKAGMKVVCLEQGPWIKPGEHPHYHDEWELEKQRG
WAYDPNVRQLPEDYPVTGTTTPYMMNNVGGSTVHYAGHWPRYKPVDFRKGTEHGLEGTID
WPISYEDLAPFYDENDEIYGISGLIGDPSYPDRKNAVRDPSVLPGKLGLKYAKASRDLGW
HWWPSDNAIITRPRENREADAAMGNELSGSPTGSLSTPANAHWPYAIRHGADLRTMARVE
TINAAGGRATGATYLDRNTGQRHEIRAKIVVLAANGIGSPRLLLQSAQKGHPDGLANSNG
IVGKYLMHHVFAFCDSWFDEPIEGFKGSFGAPLYSHEFYHTDMSRGFVNGFGMQVARSFG
PAYAAMGTHTGYTAPWGATHREFFDSHFANHLMVFMFGEDLPVETNRVTLDPDVKDSSGL
PAAHVDYDLHPNDVALAQYGIEKIFEATRAVGAVETNDTGVLYPPPGWHLMGTCRMGNDP
GDSVLNKWCQTWDVPNLFVVDGSTLTTGAAVNPTSTIGALSQRSGEYIKRNFDAIVAQKV
TPSNAAAPTM
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatacgaggagaccgacgtcctggtcatcggcgcgggccccggcggcgccggg
atcgcgctgaagctcgccaaggcgggcatgaaggtggtctgcctggagcagggcccgtgg
atcaagcccggcgagcacccccactaccacgacgagtgggagctggagaagcagcgcgga
tgggcctacgaccccaacgtgcgccagctgcccgaggactacccggtcaccgggaccacg
acgccgtacatgatgaacaacgtcggcggctcgaccgtgcactacgccgggcactggccc
cggtacaagccggtcgacttccgcaagggcaccgagcacggcctcgagggcaccatcgac
tggccgatcagctacgaggacctcgccccgttctacgacgagaacgacgagatctacggc
atctccggcctgatcggcgacccgtcctacccggaccgcaagaacgccgtccgtgacccg
agcgtgctgcccggcaagctcgggctgaagtacgccaaggcctcgcgcgacctcggctgg
cactggtggccgtcggacaacgcgatcatcaccaggccgcgggagaaccgcgaggcggac
gcggccatgggcaacgagctgtccggcagcccgaccggctcgctgtccacaccggccaac
gcgcactggccctacgccatccggcacggggcggacctgcgcaccatggcccgcgtcgag
acgatcaacgccgccggcggccgcgcgaccggcgcgacctacctcgaccggaacaccggt
cagcggcacgagatccgggcgaagatcgtcgtgctggcggcgaacgggatcgggtcgccc
cggctgctgctgcagagcgcccagaagggacatccggacgggctggccaactcgaacggg
atcgtcggcaagtacctgatgcaccacgtcttcgcgttctgcgactcgtggttcgacgag
cccatcgagggcttcaagggcagcttcggcgccccgctgtactcgcacgagttctaccac
acggacatgagccgcggattcgtcaacggattcggcatgcaggtggcacgcagcttcgga
ccggcctacgccgcgatgggcacgcacaccggctacaccgcaccgtggggtgcgacgcac
cgcgagttcttcgactcgcacttcgccaaccacctgatggtcttcatgttcggtgaggac
ctgccggtggagaccaaccgggtcaccctcgacccggacgtgaaggactcgtccgggctg
ccggccgcgcacgtcgactacgacctgcacccgaacgacgtcgcgctcgcgcagtacggc
atcgagaagatcttcgaggccacccgcgcggtcggtgcggtcgagaccaacgacaccggg
gtgctctacccgccgccgggctggcacctgatggggacctgccggatgggcaacgacccg
ggcgactcggtgctcaacaagtggtgccagacctgggacgtgccgaacctgttcgtcgtc
gacggcagcacactcaccaccggcgccgccgtcaacccgacgagcacgatcggcgcgctg
tcccagcgctccggcgagtacatcaagcgcaacttcgacgcgatcgtggcgcagaaggtg
acgccctcgaacgccgccgcgccgacaatgtag

DBGET integrated database retrieval system