KEGG   Pseudonocardia sp EC080619-01: AD017_24570Help
Entry
AD017_24570       CDS       T04234                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pecq  Pseudonocardia sp EC080619-01
Pathway
pecq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pecq01100  Metabolic pathways
pecq01110  Biosynthesis of secondary metabolites
pecq01130  Biosynthesis of antibiotics
pecq01230  Biosynthesis of amino acids
Module
pecq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pecq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AD017_24570
Enzymes [BR:pecq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AD017_24570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 AAA RuvB_N AAA_16 AAA_22 AAA_28 Cytidylate_kin AAA_5 Cytidylate_kin2 AAA_17 Mg_chelatase AAA_30 AAA_24 Zeta_toxin CoaE cobW ABC_tran dNK KTI12 RNA_helicase NB-ARC
Motif
Other DBs
NCBI-ProteinID: ALL83575
UniProt: A0A0P0SGG4
LinkDB All DBs
Position
5235901..5236590
Genome map
AA seq 229 aa AA seqDB search
MSAPGPDDAGRPWVVLVGPPGSGKTTVGTLLAERLGLVFADTDAAVVERIGKPIAEMFVQ
EGEAAFRTLEREVVAEQLRAGHGVLALGGGSVLAAETRELLGEHRVVALDVDLADGMRRT
GMSTARPLLAGVNPRATFRSLLADRAPLYAEVATVRVQTARRSPNQVVAEVLTAFGLPGE
AADADPASADPHDRPTPRQDSALPSPGFGAPDDGSGDTADGPQDRLEAR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcccccggcccggacgacgcgggccgcccctgggtcgtcctggtcggcccgccc
ggctcgggcaagacgaccgtcggcaccctcctcgcggagcggctcggcctggtgttcgcc
gacaccgacgccgccgtcgtcgagcgcatcggcaagccgatcgccgagatgttcgtgcag
gagggcgaggccgcgttccggacgctggagcgcgaggtcgtcgccgagcagctccgcgcc
gggcacggggtgctcgccctcggcggcggatcggttctcgcggccgagacccgtgaactg
ctgggggagcaccgggtcgtcgcgctggacgtcgatctcgccgacgggatgcgccgcacc
gggatgtccacggcgcggccgctgctcgccggggtgaacccgcgggcgacgttccggtcg
ctgctcgccgaccgggcaccgctctacgccgaggtcgccaccgtccgggtgcagaccgcg
cggcgcagcccgaaccaggtcgtggccgaggtgctgacggcgttcgggctgcccggcgag
gccgccgacgccgacccggcctcggccgacccgcacgaccgtccgacgccgcggcaggac
tccgccctgcccagccccggcttcggcgctcccgacgacgggtccggcgacacggcggac
ggcccgcaggaccggctggaggcccgatga

DBGET integrated database retrieval system