KEGG   Peptoniphilus sp. ING2-D1G: ING2D1G_0420Help
Entry
ING2D1G_0420      CDS       T03807                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ped  Peptoniphilus sp. ING2-D1G
Pathway
ped00473  D-Alanine metabolism
ped00550  Peptidoglycan biosynthesis
ped01100  Metabolic pathways
ped01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ped00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ING2D1G_0420 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ING2D1G_0420 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ING2D1G_0420 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ped01011]
    ING2D1G_0420 (ddl)
Enzymes [BR:ped01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ING2D1G_0420 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ped01011]
 Precursor biosynthesis
  Amino acid ligase
   ING2D1G_0420 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp ATP-grasp_4 GARS_A Big_7
Motif
Other DBs
NCBI-ProteinID: CDZ74604
UniProt: A0A090JME7
LinkDB All DBs
Position
I:435108..436286
Genome map
AA seq 392 aa AA seqDB search
MENIAVVFGGRSVEHEVSIITGMQIMENMDKTKYNPIPVYVTKEGRFLSGESLKNISTFK
HRDFSETKEVFFKGFANDKNLYTIESKKGGLFSSKSTSLEVYEKIDVVFPALHGTNGEDG
TFQGLLEMVNIPYVGCGVMSAAVGMDKIAMKEVFKAQNIPMTNYIYFYRNQWKKNQESIL
NSAEEMGYDFFVKPANLGSSIGISKAKNRDELIKAIDIAANYDSKIIIEKAVLNPREINV
AVLGYEDDLRVSLCEEPLGWKDLLSYEDKYIQGAKNGKAGMKGQKKKLPADLEEGMQKHI
ENLAIISFKAIDAAGVARIDFLVDGEEVYVNEINTLPGSISFYLFEQKGLSFTQLITELI
EIAHKKYKNNLENITSYDSDLLKKTSYGAKIQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatagcggttgtattcggcggaagaagcgtcgaacatgaagtatcaataata
acaggtatgcaaattatggaaaatatggataagaccaagtacaatcccatacctgtatat
gttacaaaggaaggaagatttttatcgggagaatctttaaaaaacatatccacttttaaa
cacagggatttttcagaaactaaagaagtgttttttaaaggctttgcaaatgataaaaat
ctatataccatagaatcgaaaaaaggcggacttttttcttcaaaatcaacttccttggaa
gtttatgaaaaaatcgatgtggtatttcccgcacttcacggaaccaacggtgaggacgga
acatttcaagggctgcttgaaatggtgaatattccctatgtgggttgtggagtaatgagc
gcagccgtaggtatggataaaattgcgatgaaagaagtattcaaagctcaaaatatcccc
atgaccaattacatttatttctacagaaatcaatggaagaaaaaccaagaaagcatattg
aattctgcagaagaaatgggatatgatttttttgtaaaaccggcaaatttaggctcatca
ataggaatatccaaggctaaaaatagagatgaattgataaaagccattgatattgcggcg
aattatgacagcaagataataatagaaaaggctgttttgaaccccagagaaataaatgta
gctgttttgggatacgaagatgatttgagagtatctttgtgtgaagaacccttgggttgg
aaagaccttctaagctatgaagataagtacattcaaggagcaaaaaacggaaaagcgggt
atgaagggacaaaagaagaaactcccggcagaccttgaagaaggaatgcaaaaacatatt
gagaatttagcaattatttccttcaaagccattgatgcggctggagttgcaagaatagat
tttttagtggatggagaggaagtatatgtaaatgagataaatactctacccggctccata
tccttctatctttttgagcaaaagggactcagcttcacacaattgatcacagaacttatt
gaaatagcacataaaaaatataaaaacaacctggaaaatataacatcctatgactccgac
cttttgaaaaagacgagctatggagcaaaaatacaatga

DBGET integrated database retrieval system