KEGG   Peptoniphilus sp. ING2-D1G: ING2D1G_0598Help
Entry
ING2D1G_0598      CDS       T03807                                 

Definition
(GenBank) putative serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ped  Peptoniphilus sp. ING2-D1G
Brite
KEGG Orthology (KO) [BR:ped00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ped01001]
    ING2D1G_0598
Enzymes [BR:ped01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ING2D1G_0598
Protein kinases [BR:ped01001]
 Serine/threonine kinases: Other
  Bacterial family
   ING2D1G_0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like RIO1 APH DUF5383 Kdo Pkinase_fungal FTA2 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: CDZ74760
UniProt: A0A090I291
LinkDB All DBs
Position
I:604494..606491
Genome map
AA seq 665 aa AA seqDB search
MIGKILGNRYEILQKIGTGGMGDVYKAHCRRLDRIVAIKTLKSEYNSDNNFIRKFKRESL
ATASISHPNIVSIYDVGTEEIDGEKVHYIVMEYIDGITLKEKIQEEGKLSEKIALNYTVQ
IAEALKVAHSKGIVHRDIKSQNIMITKDDRIKVTDFGIARIADNATVTATNAIMGSVHYF
SPEQARGTKVDNRSDIYSLGIVLYEMLTGELPFDAENPVSVALMQVQSNMPLPSSKNPQV
SQYADQIVSKMTMKDPQDRYSDVYLLIRDIKNIQLGRTGTVNYRTQTGSTGPISKTAVKS
SPILERKNLKKEEPRYIKNKVEKKNSSLPIFLGVLTAILLAFMLLYIVPKMVLTDKPEDT
QVEEVTTVKVPPLIGLSQDQAREELEKAGLTMDADFADNYEKANREVLEQSPEAGTEVEQ
GSAVKVKINVLKDVIEVPNLVGKTLEEAQALVAEAGLTINNIELEYSDEYEENLVIKQEP
ASGSEVVNDKNLTVYVSKGKEDLSQNIPNLRGVNQEEAKATLEKLGFVVKIEEIKYTGLD
VGDVVDYEPKDVADKGTEITLYVTTGPEEKPEENNTGNENSGVPESSEENSYGLPETLTV
NMPDDNARHNVVILRRTAGGDEYKIYDYNKESSEGDITVTLQYVSKGDVFEVYIDGEKVE
TKKIN
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaaaattttaggcaatagatatgaaattctacaaaaaataggtactggagga
atgggtgatgtatataaggcccattgtagaagattagatagaatagttgcaataaaaacg
cttaaatccgaatataatagcgacaataatttcattagaaaattcaaaagagaatcactt
gcgacagcaagtatctctcatcccaatatagtgagcatatacgatgtaggtactgaagaa
attgacggagaaaaagttcactatatagtaatggaatacatcgacggaataacattaaag
gaaaaaattcaagaagaaggaaaactaagtgaaaaaattgccttaaattacaccgttcaa
atagctgaagctttaaaggtagctcattctaagggtatagttcatagagatataaaatcc
caaaatattatgataactaaggatgacagaataaaggtaactgattttggaatagcaaga
atagctgataatgcaacggttactgcaacaaatgccataatgggttcagttcattatttt
tcacctgagcaagcaaggggaacaaaagtagacaacagatcggatatttattcattggga
atagttctttatgagatgcttacgggagaattaccctttgatgcggaaaatcccgtgtct
gttgctcttatgcaagttcaaagcaacatgcctcttccatcatcaaaaaatcctcaagtt
tcgcaatatgcagaccaaatagtcagtaaaatgactatgaaggatcctcaagacagatat
tctgacgtttatttgttgataagagatataaaaaacattcaattgggaagaaccggtact
gtaaactataggacgcaaacaggttctacaggtccgatatcaaaaaccgcagttaaatca
tcacctatactggaaagaaaaaatttaaagaaagaggaaccgagatatataaaaaataaa
gttgagaagaagaattcatctctacctatattcttaggcgtgttgacagcgattcttttg
gcctttatgttattgtatattgttccgaagatggtattaactgataaacccgaagatact
caagtagaagaagtaactactgttaaagttccgcctcttattggactcagtcaagatcaa
gcaagagaagaacttgaaaaagcgggattgaccatggatgctgattttgccgataattat
gaaaaagcgaacagagaagtgcttgaacaaagccctgaagctggaactgaagtagaacaa
ggttctgcagtaaaggtgaagataaatgtattaaaagatgtaatagaagtaccgaattta
gtcggtaaaactcttgaggaagctcaggctttagtagctgaagccggtcttacaattaac
aatatagaacttgaatattcagatgaatatgaagaaaaccttgtaataaaacaagaaccg
gcatccggaagtgaggtagtaaacgataaaaatttaactgtttatgtatcaaagggcaag
gaagatttgtcgcaaaatatacctaatttaagaggagtaaatcaagaggaagcaaaagca
actcttgaaaaattaggatttgttgtgaaaatcgaagaaatcaagtatacgggacttgat
gtaggtgatgttgtcgattatgaacctaaggatgtagcagataagggaactgaaattact
ttatatgtaactacaggtccggaagaaaaacctgaggagaacaatacagggaatgaaaac
agtggcgttcctgaatcttcagaagaaaacagctatggacttcctgaaaccttaacggta
aatatgcccgatgacaatgcaagacataatgtagttattttaagacgcactgccggagga
gatgagtataaaatatatgattataacaaagaatcttcagaaggagatataacggtaact
cttcaatatgtttcaaagggagatgtatttgaagtatatatagatggtgaaaaagttgaa
actaaaaaaataaattag

DBGET integrated database retrieval system