KEGG   Pelobacter sp. SFB93: A7E78_01360Help
Entry
A7E78_01360       CDS       T04594                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pef  Pelobacter sp. SFB93
Pathway
pef00061  Fatty acid biosynthesis
pef00780  Biotin metabolism
pef01100  Metabolic pathways
pef01212  Fatty acid metabolism
Module
pef_M00083  Fatty acid biosynthesis, elongation
pef_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pef00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A7E78_01360
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A7E78_01360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pef01004]
    A7E78_01360
Enzymes [BR:pef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A7E78_01360
Lipid biosynthesis proteins [BR:pef01004]
 Fatty acid synthase
  Component type
   A7E78_01360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: APG26627
UniProt: A0A1L3GL00
LinkDB All DBs
Position
307928..308371
Genome map
AA seq 147 aa AA seqDB search
MELNAQDIMKVLPHRYPFLLVDRIVELEVGTRAVGIKNVTINEPFFQGHFPDHPIMPGVL
ILEALAQVGGVTAALAEKDVDDKVTYFVGIDKARFRKPVTPGDVLRLEMDIKYCKRGIYC
FEGKAYVEDKLVAQAELKATFAPREES
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggagctcaacgcacaggatataatgaaggtacttccgcatcgctacccttttttactg
gtagatcgtatcgtggaattggaggtcgggactcgagcggtcggcatcaagaacgtgacc
attaatgagcccttttttcaaggacattttccggatcaccccattatgccgggagtgctg
attctggaagcactggctcaggtcggcggtgtaactgccgccctggccgaaaaggatgtc
gatgacaaggtgacttactttgtcggtatcgataaggcgcgttttcgcaagcctgttact
cccggagatgtgttgcgtttggagatggatattaaatattgcaagcgcggtatatactgt
tttgaaggcaaagcctacgttgaagacaagctcgtagcacaagctgaattgaaagccacg
ttcgcaccacgcgaagaatcttga

DBGET integrated database retrieval system