KEGG   Pelobacter sp. SFB93: A7E78_04710Help
Entry
A7E78_04710       CDS       T04594                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pef  Pelobacter sp. SFB93
Brite
KEGG Orthology (KO) [BR:pef00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7E78_04710
Enzymes [BR:pef01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A7E78_04710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 GIDA Pyr_redox NAD_binding_9 NAD_binding_7 K_oxygenase HI0933_like FAD_binding_2 AlaDh_PNT_C NAD_binding_8 FAD_oxidored Thi4 DAO
Motif
Other DBs
NCBI-ProteinID: APG29024
UniProt: A0A1L3GSU4
LinkDB All DBs
Position
1041003..1041923
Genome map
AA seq 306 aa AA seqDB search
MIIIGGGPAGLTAATFAATLKMKAFLIARDLGGQAVDSTKIENYMGFDFITGPELVSRFQ
NQLLHSHFVDHLMDEVTRIIPEKDAFHVVTRGEDTFLTNAVLVTTGMTRKKLYIPGEEEF
QRRGVFYGNIPDFSFVEGEEVAVIGGGNSALQIVENLRTLARRIHLVSTSKLKADPAIIE
RVKVFPNLTVYEGYRTLQFAGENSLTTVEIEKMSGGKRLCLSVQGVFVAIGHEPNSALVA
DLVALNEKEEIVIRPDCATSRPGIFAAGDVTDAFGKRIIIASGEGAKAALAAKAYLLKKA
GAEAIR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ctgatcatcatcggtggagggccggctggactgacggcggcaaccttcgccgccactcta
aagatgaaggcttttttgatcgccagggatctgggtggtcaggcggtcgatagcaccaag
attgaaaactacatggggtttgacttcatcaccggcccagagctggtctcccgttttcag
aatcagttgcttcattcccattttgttgaccacctgatggatgaggtgacccgaatcatt
cccgagaaagatgcgttccacgtcgtcactcgcggagaggatacctttttgactaacgct
gtcctggttactaccggcatgactcgaaagaagctttatatccccggagaggaggagttt
caacggcgtggtgtattctacgggaatatccccgacttctccttcgttgagggcgaggag
gtggccgttatcggaggcggtaacagcgccctgcagatcgtggaaaaccttcgaaccctc
gcccgccgaatccacctcgtttccacatccaaactgaaggccgatccggccattatcgaa
cgggtaaaggtattccctaacctgacagtatacgaagggtacaggacgttgcaatttgct
ggggagaattctctgaccacggttgagatagagaaaatgtctgggggaaaacgcctctgc
ctttccgtccagggggtatttgttgcaattggccatgaacccaactcggccttggtggcg
gaccttgtggccctgaatgaaaaagaagaaattgttataaggccggattgtgccacctca
cgtcctggcattttcgcagcaggcgatgtcaccgatgcattcggcaagcggattattatc
gcttctggcgagggtgctaaagccgctcttgcggcgaaggcgtatcttttgaaaaaagca
ggcgcggaagccataaggtaa

DBGET integrated database retrieval system