KEGG   Phycicoccus endophyticus: H9L10_07420
Entry
H9L10_07420       CDS       T06776                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
pei  Phycicoccus endophyticus
Pathway
pei00620  Pyruvate metabolism
pei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H9L10_07420
Enzymes [BR:pei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     H9L10_07420
SSDB
Other DBs
NCBI-ProteinID: QNN50752
LinkDB
Position
complement(1531143..1534592)
AA seq 1149 aa
MSDTRTSSEASPTTEAITLRLAALGLPLPPGAESDSALQLATPILARNRELSRRLADRPC
AADRRIQAFLDDFLANAPVRPQLPRRTLVLDEPGLARELTLPRDGDEFTSRLVASYRLAN
GVLHNPANDRRTTAGVFHIAEGGLPIQDDKLAVPNAVYARLLEEALRPPAEDLVLPWTAT
APEPARTWVSLLLRPVVVPATGASPLARSMETRFIVPGGLVCNLDFVETVFGNAGDPYLP
ENDASLDPVSWTGHTGCVILAPHLTALTKRELGLPHVDDATERQRRDGMCWTTSDERYNG
GKAFKVTARDARGVVVTVIADNYFGYCKKEVKTQISYAANLFGMAEEEHSGGAICYPAYN
LGQEYTDTFTPEDYSVREVLAGNPGRFEPRPEGHAVDTRLPQLTLVPTGAAFSIPRRAVT
WTGRRGERYEIPLDADRVYMTPNGYRVFAKPREADPTQWHLLGISPLSTQCHKPATVSGG
GKSEISKSLMDAVVFGHATTLGFDADMDAVADLVGTDFSGRYRDPQRPRDERSLLSAERT
LGSVIKLLTPNEDFTDEYNAWLEEIPPHVKELVYLVKKYYEPEWGEDWRSHFSVSTINGR
EGSRVRLDGELVIVNMLRLGFTPDGSWRLFSLRPDFSPAVKVQSEDDITASVVLPETLAP
LDFGDHRGLTEARREARSRPAVSRKYVTNCERLLFQRPDDAIHRGYDKQAERDIATPGTF
LSNFQPLTRADAAEMVRDAVAFSRYTPPMADLLARFATTEEGPGFVVSSSEPRLVGGVPT
KNPRYLQPRPDTADPTATALADVASHLALKRPLDELAPLPVDVVAAGRRNNPPEAGSPAL
CSYNPLHYMELPELFMEFISSMTGKSPSTTGAGSEGALTKGPFNMLPSVIDLNAAFLSYA
LTGYDGWVSGAGYIGPRIRVDHDFSLLVPELFARMWPSERDARALIDNGFLEKVPDVERE
GMTVEASRLGYRMNHRFATTFFGRIFLHPETVFTDEMLAPELQGADVYADSVEVIIETHR
RVAQSYIDDGTIELAVPPLRALLQYMALGKTDEGWTLQSPELRSQFTRESVLASDWYAER
LDAKRSYDIDHYERSVADLERFLAGDTNADTADRLHVQRRLQDVTAELARVSAPGYAAEL
VGTVGRQPL
NT seq 3450 nt   +upstreamnt  +downstreamnt
atgtccgacacccgaacctcgtcagaagccagcccgacgacggaggcgatcaccctccgg
ctcgcggcgctcggcctgcccctcccgccgggagcggagagcgacagcgccctgcagctc
gcgacgccgatcctcgcccgcaaccgcgagctgagccgccggctcgccgaccggccgtgc
gccgccgaccggcgtatccaggccttcctcgacgacttcctcgccaacgcccccgtccgg
ccccagctgccgcggcgcacgctggtcctcgacgagcccggcctcgcccgagagctcacc
ctgccccgggacggcgacgagttcacctcacgcctcgtggccagctaccgcctggccaac
ggcgtcctgcacaacccggccaacgaccgccgcacgacggccggggtcttccacatcgcc
gagggtgggctgcctatccaggacgacaagctcgccgtgcccaacgccgtctacgcgcgc
ttgctcgaggaggcgctgcggcctcccgcggaggacctcgtcctcccttggaccgccacc
gcgccggagccggcgcgcacctgggtctccctcctcctgcggcccgtcgtcgtgccggcc
acgggcgccagcccgctcgcccgcagcatggagacccggttcatcgtccccggcggcctc
gtgtgcaacctcgacttcgtcgagacggtcttcggcaacgccggcgacccctaccttccc
gagaacgacgcctcgctggacccggtgtcgtggacggggcacaccggctgcgtcatcctc
gcgccgcacctgaccgcgctgaccaagcgcgagctcgggcttccgcacgtcgacgacgcc
accgagcgtcagcggcgcgacggcatgtgctggaccacctccgacgagcggtacaacggc
ggcaaggcgttcaaggtcaccgcccgggacgcccgtggcgtcgtcgtcaccgtcatcgcc
gacaactacttcggctactgcaagaaggaggtcaagacccagatcagctacgccgccaac
ctcttcgggatggccgaggaggagcactccggcggcgcgatctgctacccggcctacaac
ctcggccaggagtacaccgacaccttcacgccggaggactacagcgtgcgggaggtgctc
gccggcaaccccggccgcttcgagccccggccggaggggcacgccgtcgacacccggctg
ccccagctgacgctcgtgcccacgggtgccgccttcagcatcccgcgccgtgccgtgacc
tggacggggcgccgtggggagcgctacgagatccccctggacgccgaccgggtctacatg
acccccaacggctaccgggtcttcgccaagccccgcgaggccgaccccacccaatggcac
ctgctcggcatctcgccgctgtcgacccagtgccacaagccggcgaccgtctccggcggg
ggcaagagcgagatcagcaagtcgctcatggacgccgtcgtcttcgggcacgcgaccacc
ctcggcttcgacgccgacatggacgccgtcgccgacctcgtcggcaccgacttctccggc
cgctaccgcgacccccagcgcccgcgggacgagcgcagtctgctctccgccgagcgcacg
ctcggcagcgtcatcaagctgctcacgccgaacgaggacttcaccgacgagtacaacgcc
tggctcgaggagatcccgccgcacgtcaaggagctggtgtacctcgtcaagaagtactac
gagccggagtggggcgaggactggcgcagccacttctcggtgagcacgatcaacggccgc
gagggcagccgggtgcgcctggacggcgagctggtcatcgtcaacatgctccggctcggg
ttcaccccggacggctcgtggcggctgttctcgctgcggcccgacttcagccccgcggtc
aaggtgcagagcgaggacgacatcaccgcgagcgtcgtcctccccgagaccctcgcgccg
ctcgacttcggcgaccaccgtggcctcaccgaggcccgccgggaggcgcgcagccgcccc
gcggtctcgcgcaagtacgtcaccaactgcgagcggctgctcttccagcgcccggacgac
gcgatccaccgcggctacgacaagcaggccgagcgcgacatcgccaccccgggcaccttc
ctctccaacttccagccgctgacccgggccgacgccgccgagatggtgcgcgacgcggtg
gccttcagccgctacaccccgccgatggccgacctgctggcccgtttcgcgacgaccgag
gaggggcccggattcgtcgtctcctcctccgagccccggctcgtcggcggcgtgccgacg
aagaacccccgctacctgcagccgcgcccggacactgccgacccgacggccaccgccctc
gccgatgtcgcgagccacctcgcgctcaagcggcccctggacgagctcgccccgctgccg
gtcgacgtcgtcgccgcggggcggcgcaacaacccgcccgaggcggggtccccggcgctg
tgctcgtacaaccccctgcactacatggagctgcccgagctgttcatggagttcatcagc
tcgatgaccggcaagtcgccctcgacgacgggagccgggtccgagggcgccctcaccaag
ggcccgttcaacatgctgccttcggtgatcgacctcaacgcggccttcctctcctacgcc
ctcaccggctacgacggctgggtctccggtgccgggtacatcggccctcggatccgggtc
gaccacgacttcagcctgctcgtgcccgagctgttcgcccggatgtggccgagcgagcgg
gacgcgcgcgccctcatcgacaacggcttcctcgagaaggtgcccgacgtcgagcgtgag
gggatgaccgtcgaggccagccgcctcggctaccggatgaaccaccgcttcgcgacgacc
ttcttcgggcggatcttcctgcacccggagacggtcttcaccgacgagatgctcgccccc
gagctgcagggcgccgacgtctacgccgacagcgtcgaggtcatcatcgagacccaccgt
cgggtcgcgcagtcctacatcgacgacggcacgatcgagctcgccgtgcccccgctgcgt
gcgctgctgcagtacatggccctgggcaagaccgacgagggctggacgctgcagtcgccc
gagctgcgctcgcagttcacccgcgagagcgtgctcgccagcgactggtacgccgagcgg
ctggacgccaagcgcagctacgacatcgaccactacgagcgctcggtggccgacctcgag
cgcttcctcgccggcgacaccaacgccgacaccgccgaccggctgcacgtccagcgccgc
ctgcaggacgtcacggccgagctggcccgggtgtcggcaccggggtacgccgccgagctg
gtcggcacggtcgggcgccagcccctctga

DBGET integrated database retrieval system