KEGG   Candidatus Pelagibacter sp. IMCC9063: SAR11G3_00211Help
Entry
SAR11G3_00211     CDS       T01465                                 

Definition
(GenBank) hypothetical protein
Organism
pel  Candidatus Pelagibacter sp. IMCC9063
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecR
Motif
Other DBs
NCBI-ProteinID: AEA80686
UniProt: F2I3F7
LinkDB All DBs
Position
complement(186144..187379)
Genome map
AA seq 411 aa AA seqDB search
MKKILSPIILLFFVFNISQADAKIDISKQLVGIVGAVSGTAKAGTRELKAGDKVYLNETI
YAGIDSGTQILLLDQSTFTIGSDSEVVMDTFIYDPATNDGKIVANVKKGSLKIISGLISK
KNPDSLTVNVPEGTLGSRGTEFQTIVSNQKTDTLLIGPGKNNTLGLRPGAVLVGNNLGQT
LLDNPYSVASMVQGSAPGKAKQITKNQLKKFKKRMKVVRVAKLDGTTKEERKATRKKIRQ
ELKAQGFDKEEIKILIKENIKKDEEKRIVLLKTNEEEVSDITQSENIVEEKVIETEEKIV
VAKKDEKKNTKEVKKKDKKKKNKKKNTKEVKKKDKKKKDKKKNKKQVKKKDKKKKAVKKK
GKTKKKKVKKKKVKKKKIKKKKVIKKKAKKITRKKIAKKKRKARNKRKRKK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattttatcaccaatcatactattattttttgtattcaatatcagccaggcg
gatgcaaaaattgatattagtaagcaattagtcggaattgtaggtgcagtatctggaaca
gctaaagctggcacaagagaacttaaagctggcgataaagtttatttaaacgaaacgatt
tatgcaggaatagattcgggcacacaaatattactactagatcaatcaacatttaccatt
ggatcagattcagaagtagttatggatacctttatatacgatccagcaacaaatgatgga
aaaattgtagcgaatgttaaaaaaggaagtttaaaaataatttcaggtttaataagcaaa
aagaatccagacagcttaactgttaacgttcctgaaggaactttaggttcaagaggaaca
gagtttcaaaccatagtatcaaatcaaaaaacagatactttattaataggaccaggaaaa
aataacacattgggtttaaggcctggggcagttctggttggaaataatttgggtcaaaca
ctactggataatccttacagtgtagcaagtatggttcaaggtagtgcaccaggaaaagca
aaacaaataactaaaaaccaactaaaaaaatttaaaaaaagaatgaaagtagttagagtg
gcaaagcttgatggaactacaaaagaagaaagaaaagctactagaaaaaaaattagacaa
gaacttaaagcccagggttttgataaagaagagataaaaatattaattaaagaaaatatt
aaaaaagacgaagaaaagagaattgttttactaaaaacaaatgaagaagaggtgtcagac
ataacacaatctgaaaacattgttgaagaaaaagttattgaaacagaagaaaaaatagtg
gttgcgaaaaaagatgaaaagaaaaatacaaaagaagtaaagaagaaagataaaaagaaa
aaaaataaaaagaaaaatacaaaagaagtaaagaagaaagataaaaagaaaaaagataaa
aagaaaaataaaaaacaagtaaagaaaaaagacaaaaagaaaaaagcagtgaagaaaaaa
ggcaagactaaaaagaaaaaagttaaaaagaaaaaagtaaaaaagaaaaaaattaaaaag
aaaaaagtaataaagaaaaaagcaaaaaaaataacaagaaaaaaaatagctaagaaaaaa
agaaaagccagaaacaaaagaaaacgtaagaaataa

DBGET integrated database retrieval system