KEGG   Pseudomonas entomophila: PSEEN0334Help
Entry
PSEEN0334         CDS       T00362                                 

Gene name
aroK
Definition
(GenBank) shikimate-kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pen  Pseudomonas entomophila
Pathway
pen00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01130  Biosynthesis of antibiotics
pen01230  Biosynthesis of amino acids
Module
pen_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSEEN0334 (aroK)
Enzymes [BR:pen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PSEEN0334 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin Cytidylate_kin2 AAA_33 AAA ABC_tran AAA_16 AAA_25 Rad17 AAA_22 AAA_5 TsaE Guanylate_kin dNK AAA_24 AAA_29
Motif
Other DBs
NCBI-ProteinID: CAK13294
UniProt: Q1IGA8
LinkDB All DBs
Position
345819..346337
Genome map
AA seq 172 aa AA seqDB search
MRNLILVGPMGAGKSTIGRLLAKELRLLFKDSDKEIELRTGANIPWIFDKEGEPGFRERE
QAMIAELCALDGVVLATGGGAVMRDANRAALRAGGRVVYLHASVEQQVGRTSRDRNRPLL
RTANPEATLRALFEARDPLYREIADLVVETDERPPRMVVLDILERLQQLPPR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaatttgatacttgtggggcccatgggcgctggtaagagcaccatcgggcgcctg
ttggccaaagagctgcgcctgctgttcaaggattccgacaaggaaatcgaactgcgaacc
ggcgccaacatcccgtggatcttcgacaaggaaggcgagccgggctttcgtgagcgtgag
caggcgatgatcgccgaactctgcgcactcgacggcgtggtcctggccaccggcggcggc
gcggtgatgcgtgacgccaaccgtgccgcattgcgagcgggcggccgggtggtctacttg
catgcttcggtggagcagcaggtcgggcgcacctcgcgggaccgcaaccgccccttgctg
cgcaccgccaacccggaagcgaccctgcgtgccttgttcgaagcgcgtgacccgctctat
cgcgagattgccgacctggtggtggaaaccgacgaacggccgccacgcatggtggtgctc
gacattctggagcgcctgcagcagttgccgccccgataa

DBGET integrated database retrieval system