KEGG   Pseudomonas entomophila: PSEEN0475Help
Entry
PSEEN0475         CDS       T00362                                 

Gene name
tufB
Definition
(GenBank) protein chain elongation factor (EF-Tu-B)
  KO
K02358  elongation factor Tu
Organism
pen  Pseudomonas entomophila
Brite
KEGG Orthology (KO) [BR:pen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pen03012]
    PSEEN0475 (tufB)
   03029 Mitochondrial biogenesis [BR:pen03029]
    PSEEN0475 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pen04147]
    PSEEN0475 (tufB)
Translation factors [BR:pen03012]
 Eukaryotic Type
  Elongation factors
   PSEEN0475 (tufB)
 Prokaryotic Type
   PSEEN0475 (tufB)
Mitochondrial biogenesis [BR:pen03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PSEEN0475 (tufB)
Exosome [BR:pen04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PSEEN0475 (tufB)
  Exosomal proteins of breast cancer cells
   PSEEN0475 (tufB)
  Exosomal proteins of colorectal cancer cells
   PSEEN0475 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: CAK13422
UniProt: Q1IFW8
LinkDB All DBs
Position
498083..499276
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAVVEFDKIDSAPEEKARG
ITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDAYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgatcgttccctacctcacgtcaacgtcggcaccatcggccac
gtagaccacggtaagaccactctgactgcagcgctgactcgcgtctgctccgaagttttc
ggttcggccgtcgttgagttcgacaagatcgactcggctccagaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgtcgagtacaactcgaacattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccacaaacccgtgagcacatc
ctgctgtctcgtcaggttggcgttccgtacatcgtggtcttcctgaacaaggctgacctg
gtagatgacgctgagctgctggaactggtcgagatggaggttcgcgacctgctgtccacc
tacgacttcccaggcgacgacaccccgatcatcatcggttcggctcgtatggcgctggaa
ggcaaagacgacaacgaaatgggcactaccgctgtcaagaagctggtagaaactctggat
gcctacattcctgagccagttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggccgtatcgagcgtggtatcgtc
cgcgttcaagacccgctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggcgttgagatgttccgcaagctgctggacgaaggtcgtgctggcgagaactgcggcgtc
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgtcctgtcgaaggaagaaggc
ggccgtcacactccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgtcaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgccatc
cgtgaaggcggtcgtaccgtcggcgccggcgtcgtagcaaaaattattgaataa

DBGET integrated database retrieval system