KEGG   Pseudomonas entomophila: PSEEN1072Help
Entry
PSEEN1072         CDS       T00362                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pen  Pseudomonas entomophila
Pathway
pen00970  Aminoacyl-tRNA biosynthesis
pen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pen00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSEEN1072 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pen03029]
    PSEEN1072 (gatA)
Enzymes [BR:pen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PSEEN1072 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PSEEN1072 (gatA)
Mitochondrial biogenesis [BR:pen03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PSEEN1072 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase RDM
Motif
Other DBs
NCBI-ProteinID: CAK13972
UniProt: Q1IED3
LinkDB All DBs
Position
complement(1124894..1126345)
Genome map
AA seq 483 aa AA seqDB search
MHQLTLAEIARGLADKSFSSEELTGALLSRIKQLDPQLNSFITVTEEQALHQARAADARR
AAGETGALLGAPIAHKDLFCTQGVRTSCGSKMLDNFTAPYDATVVAKLAEAGMVTLGKTN
MDEFAMGSANESSHYGAVKNPWNLEHVPGGSSGGSAAAVAARLLPATTGTDTGGSIRQPA
ALTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCALLLQGMAGFDSKDSTSVEE
PVPNFSADLNASLQGLRIGLPKEYFGAGLDPRIAERVQASVKELEKLGAVVKEISLPNMQ
HAIAAYYVIAPAEASSNLSRFDGVRFGHRCADPKDLTDLYKRSRGEGFGVEVQRRIMVGT
YALSAGYYDAYYVKAQQIRRLIKNDFVAAFNDVDVIIGPTTPNPAWKIGAKAGDPIAEYL
EDLYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNIAHRYQQVTDWHTRAP
NGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaattgaccctggccgagatcgcccgcggactcgccgacaagtcgttctcctcg
gaagaactgaccggcgcactgctgtcgcgcatcaagcagctcgacccgcagctcaacagc
ttcatcaccgtcaccgaagaacaggccctgcaccaggcccgcgccgccgacgcccgtcgc
gccgccggcgagaccggcgcgctgctcggcgcgccgatcgcccacaaggacctgttctgc
acccaaggcgtgcgcaccagctgcggctcgaagatgctcgacaacttcaccgccccgtac
gacgccaccgtggtcgccaagctggccgaagccggcatggtcacgctgggcaaaaccaac
atggacgaattcgccatgggttcggccaacgaatccagccactacggcgcggtgaagaac
ccgtggaacctcgagcacgtgccgggcggctcgtccggtggctcggccgccgcagtggcc
gcgcgcctgctgccggccaccaccggcaccgacaccggcggctcgatccgccagccggcc
gcgctgaccaacctcaccggcctgaaaccgacctacggccgcgtttcgcgctggggcatg
atcgcctacgcctcgagcctcgaccagggcggcccgctggcccgcaccgccgaagactgc
gccctgctgctgcaaggcatggccggcttcgacagcaaggactcgacctcggtcgaggag
ccggtaccgaacttcagcgccgacctcaacgcctcgctgcaaggcctgcgcatcggcctg
ccgaaagagtacttcggcgccggcctcgacccgcgcatcgcggaacgggtccaggccagc
gtcaaggagctggaaaagctcggcgcggtggtcaaggaaatcagcctgccgaacatgcag
cacgccattgcggcctactacgtgatcgccccggccgaagcctcctccaacctgtcgcga
ttcgatggcgtgcgcttcggccaccgctgcgcggacccgaaggacctgaccgacctgtac
aagcgctcccgtggcgaaggcttcggcgttgaagtgcagcgccgcatcatggtcggcacc
tacgccctgtcggccggctactacgacgcctactacgtcaaggcgcagcagatccgccgc
ctgatcaagaacgacttcgtcgcggcgttcaacgatgtcgacgtgatcatcggcccgacc
acgccgaacccggcctggaagatcggcgccaaggccggcgacccgatcgccgagtacctg
gaagacctctacaccatcaccgccaacctggcgggcctgccgggcctgtcgatgccggcc
ggtttcgttgatggcctgccggtgggcgtgcagctgctggccccgtatttccaggaaggc
cgcctgctcaacatcgcgcaccgttaccagcaagtcaccgactggcacacccgcgcccct
aacggcttctga

DBGET integrated database retrieval system