KEGG   Pseudomonas entomophila: PSEEN1121Help
Entry
PSEEN1121         CDS       T00362                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pen  Pseudomonas entomophila
Brite
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSEEN1121 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAK14021
UniProt: Q1IE87
LinkDB All DBs
Position
complement(1173901..1174497)
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLAPNAGGQPTGALADAITAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWKFVAEQFEGKTFKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgccgccgctgccgtacgcccacgatgccctgcagccgcacatctcc
aaggaaaccctggagtatcaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtcccaggcaccgaattcgaaggcaagaccctggaagagatcgtcaagagctct
tcgggcggcatcttcaacaacgccgctcaagtctggaaccacaccttctactggaactgc
ctggcaccgaacgctggcggccaaccaaccggcgccctggctgacgccatcaccgccgcc
ttcggttccttcgacaagttcaaggaagagttcaccaagacgtcggtcggcaccttcggc
tccggctggggctggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggcgccggctgcccgctgaccagcggcgacaccccgctgctgacctgcgatgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaagcgttctggaac
ctggtcaactggaagttcgttgccgagcagttcgaaggcaagaccttcaaggcctga

DBGET integrated database retrieval system