KEGG   Pseudomonas entomophila: PSEEN1621Help
Entry
PSEEN1621         CDS       T00362                                 

Gene name
fabF
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
pen  Pseudomonas entomophila
Pathway
pen00061  Fatty acid biosynthesis
pen00780  Biotin metabolism
pen01100  Metabolic pathways
pen01212  Fatty acid metabolism
Module
pen_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pen00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSEEN1621 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PSEEN1621 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pen01004]
    PSEEN1621 (fabF)
Enzymes [BR:pen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     PSEEN1621 (fabF)
Lipid biosynthesis proteins [BR:pen01004]
 Fatty acid synthase
  Component type
   PSEEN1621 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc Keratin_2_head
Motif
Other DBs
NCBI-ProteinID: CAK14478
UniProt: Q1ICY5
LinkDB All DBs
Position
1687657..1688901
Genome map
AA seq 414 aa AA seqDB search
MSRRRVVVTGMGMLSPLGTDVPSTWQGILAGRSGIGPIEHTDLSAYSTRFGGSVKGFEVE
QYLSAKEARKLDLFIQYGLAAGFQAVRNAGLEVTDANRERIGVAMGSGIGGLTNIEETSR
TLHEQGPRRISPFFVPGSIINMISGFLSIHLGLQGPNYAIATACTTGTHCIGMAARNIAY
GEADVMIAGGAEMAACGLGMGGFGASRALSTRNDEPARASRPWDKGRDGFVLSDGAGALV
LEELEHAKARGATIYAELVGFGMSGDAYHMTSPPDSGEGAARCMANALRDAGIKPEEVSY
INAHGTSTPAGDVAEVAAIKRVFGEHAYKLAVSSTKSMTGHLLGAAGAVEAIFSVLAINS
QMAPPTINLDEPDEGCDLDFVPHQARSMPIDVVLSNSFGFGGTNGSLVFRRFAD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgtagacgcgtcgtggtcaccggtatgggtatgctgtcgccactgggtaccgat
gtaccaagcacctggcaaggcattctggctggccgcagtggcatcggtccgatcgagcat
acggacctgtctgcctactccacccgttttggcggctcggtgaaaggcttcgaggtcgag
caatacctgtcggccaaagaggcccgcaagctcgatctgttcattcagtacggcctggcg
gccggtttccaggcggtacgcaatgccggcctggaagtcaccgacgccaaccgcgagcgc
atcggcgtggccatgggctcggggatcggcggcctgacgaacatcgaagagaccagccgt
accctgcatgagcaaggtccgcggcggatctcgccgttcttcgtaccgggctcgatcatc
aacatgatctccggtttcctgtcgatccacctggggttgcaggggccgaactacgccatc
gccaccgcgtgcaccaccggcacccactgcatcggcatggccgcgcgcaacatcgcctac
ggcgaagcggacgtgatgatcgccggtggcgccgagatggctgcctgcggcctgggcatg
ggcggtttcggcgcatcccgtgcgttgtcgacccgcaatgacgaaccggcccgcgccagc
cgcccgtgggacaaggggcgtgacggtttcgtgctgtccgacggtgccggtgccctggtg
ctcgaagagctggagcacgccaaggcccgtggcgcgaccatctatgcggaactggtcggt
ttcggcatgagcggtgatgcctaccacatgacctcgccacccgactccggcgaaggcgcc
gcccgctgcatggccaacgccttgcgcgatgccggtatcaagccggaggaagtcagctac
atcaacgcccacggcacctcgacgcctgcaggcgacgtggccgaagtggcggcgatcaag
cgtgtgttcggcgagcatgcctacaagctggcggtcagttcgaccaagtcgatgaccggt
cacctgctgggtgccgccggtgcggtggaggcgatcttcagcgtactggccatcaacagc
cagatggcgccgcccaccatcaacctggatgaaccggacgaaggttgcgacctggacttc
gtgccgcaccaggcacgcagcatgccgatcgatgtggtgctgtccaactccttcggcttt
ggcggaaccaacggttcgctggtgttccgccggttcgccgactga

DBGET integrated database retrieval system