KEGG   Pseudomonas entomophila: PSEEN1638Help
Entry
PSEEN1638         CDS       T00362                                 

Definition
(GenBank) putative HlyD family secretion protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
pen  Pseudomonas entomophila
Brite
KEGG Orthology (KO) [BR:pen00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pen02000]
    PSEEN1638
Transporters [BR:pen02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   PSEEN1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD Biotin_lipoyl lci Phage_GP20 MscS_porin THOC7 HrpB7 DUF4763 TMF_DNA_bd CENP-F_N OEP
Motif
Other DBs
NCBI-ProteinID: CAK14494
UniProt: Q1ICW9
LinkDB All DBs
Position
complement(1705762..1706919)
Genome map
AA seq 385 aa AA seqDB search
MLAGSGHRAPAMALSSLVTAPATAVKFAYIFGILVPMPAQLKRRLLIFITLVLLVGLGFL
AHWYFKGRFYESTDNAYVQGEITRISSQLGARIDEVRVEDNQHVNKGDLLVRLEVADFEL
AIERARAALATREAERVQAQSRLAQQGSLIAAGQAQVAASQATLDRSQLDLNRAQALRKP
GFISEERVTTLSADSHVARSQVDKAQADLKGQRQQVDALTAELKRLDAQIANARADLAQA
ELNLTRCEIHAPISGTIGQRSARNGQVVQAGAYLLSIVPDEAIWVQANFKETQIGRMHPG
QRAELVFDSYPDTPIEGRVNSLFAASGAQFSLLPPDNATGNFTKVVQRIPVKLTFAADNP
LHGRIRPGMSVTATVDLRDGDADGR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagggagcgggcaccgggctccagcaatggcgctatcgtcacttgtgacggcg
ccggctaccgctgttaaatttgcttacatttttggaatcctggtccccatgcccgcccaa
ctcaaacgtcgcctgctgatcttcatcaccctggtgctgctcgtcggccttggcttcctc
gcccactggtacttcaaggggcgcttctacgaaagcaccgacaacgcctatgtgcagggc
gagatcacgcgcatttccagccagctgggggcgcgtatcgatgaggtgcgggtggaagac
aaccagcatgtcaacaaaggcgacctgctggtgcgcctggaggttgccgatttcgaactg
gcgatcgaacgcgcccgtgcggccctggccacccgcgaggccgaacgggtgcaggcgcag
agccgcctggcccagcaaggcagcctgatcgccgccggccaggcccaggtcgccgccagc
caagccaccctcgaccgctcgcagctcgacctcaaccgcgcccaggccctgcgcaagccc
ggtttcatctctgaagagcgggtcaccaccctgtcggcggacagccatgtcgcccgttcc
caggtcgacaaggcccaggccgacctcaagggccagcgccagcaggtcgatgccctgacc
gctgaactcaagcgcctggacgcacagatcgccaatgcccgcgccgacctggcacaggcc
gaactgaacctgacccgctgcgagatccacgcgccgatcagcggcaccatcggccagcgc
agcgcgcgcaacggccaggtggtgcaggccggcgcctacctgttgtcgatcgtccccgac
gaggccatctgggtgcaggccaacttcaaggaaacccagatcggcaggatgcatcctggg
cagcgcgctgaactggtgttcgacagctacccggacacaccgatcgaaggccgcgtgaac
agcctgttcgccgcctccggcgcccagttcagcctgctgccaccggacaacgccaccggc
aacttcaccaaggtggtgcagcgcattccggtcaagctgaccttcgccgccgacaacccg
ctgcatggccgaatccgcccgggcatgtcggtcaccgccacggtcgacctgcgcgatggg
gatgcggatggccggtga

DBGET integrated database retrieval system