KEGG   Pseudomonas entomophila: PSEEN2297Help
Entry
PSEEN2297         CDS       T00362                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pen  Pseudomonas entomophila
Brite
KEGG Orthology (KO) [BR:pen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSEEN2297 (ahpF)
Enzymes [BR:pen01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSEEN2297 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored DAO FAD_binding_3 NAD_binding_7 Glutaredoxin FMO-like K_oxygenase Thi4 NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: CAK15110
UniProt: Q1IB56
LinkDB All DBs
Position
2385624..2387186
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLKTYLERVTQPIEIVASLDDGAKSRELHDLLVEIAGLSNLITFSADGNDAR
RPSFSLNRPGSDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIQGLQGEFTF
ETYFSLSCQNCPDVVQALNLMAVLNPNVRHVAIDGALFQDEVEARKVMAVPSIYLNGEVF
GQGRMGLEEILGKIDTSAGARQAEKINAKEAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTLAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRGEALIPATDGGL
HEVRLAGGASLKAKTVILATGARWREMNVPGEQEYRARGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAQVTLIEFDSQLRADAVLQRKLHSLPNVKVITSALTTEVVGNGE
KVTGLRYKDRTSDTLHDLALEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDAKGATSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaatcgcaactgaaaacctacctggagcgggtcacccagccg
atcgagatcgtagcctccctcgacgacggcgcgaagtcccgcgaattgcacgacctgctg
gtggaaatcgccggcctgtcgaacctcattaccttcagcgcggacggcaatgacgcccgt
cgtccttcgttctcgctgaaccgcccggggagcgatatcagcctgcgcttcgccggcatc
cccatgggccacgaattcacctccctggtactggcgctgctgcaagtcggcggccacccg
tcaaaggccagcgccgaagtgatcgagcagatccaggggctgcaaggtgaattcaccttc
gagacctacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctcaaccccaatgtgcgccacgtggccatcgatggcgcgctgttccaggat
gaagtcgaggcccgcaaggtcatggcggtgccgagcatctacctgaacggcgaagtgttc
ggccagggccgcatgggcctggaagaaatcctcggcaagatcgacaccagcgccggtgct
cgtcaggccgagaagatcaacgccaaggaagccttcgatgtgctggtggtcggcggtggg
cccgcaggtgccgcagcggcgatctatgccgcgcgcaaaggcatccgtaccggtgtcgcc
gccgaacgcttcggtggccaggtgctcgataccctggcgatcgagaacttcatctcggtg
caggagaccgaagggccgaagctggcaacggccctggaagagcacgtcaagcagtacgac
gtcgacatcatgaacctgcagcgcggcgaagcgctgatcccggccaccgacggcggcctg
cacgaagtgcgcctggctggcggcgcctcgctcaaggccaagaccgtgatcctggccacc
ggcgcccgctggcgcgagatgaacgtgccaggtgaacaggagtaccgtgcccgtggcgtg
gcctactgcccgcactgcgacggcccactgttcaagggcaagcgcgtggcggtgatcggc
ggcggcaactccggcgtggaagcggccatcgacctggcgggtatcgtcgcccaggtgacc
ctgatcgagttcgacagccagctgcgcgccgatgccgtgttgcaacgcaagctgcatagc
ctgccgaacgtcaaggtgatcaccagcgcgctgacgactgaagtggttggcaatggcgag
aaggtcaccggcctgcgctacaaggaccgcaccagcgacacgctgcatgatctggcgctg
gagggcatcttcgtgcagatcggcctgctgccgaacaccgattggctcaagggcacggtc
gagctgtcgccacgtggcgagatcatcgtcgatgccaagggcgcgaccagcatcccgggc
gtgtttgcggcgggtgacgtgaccaccgtgccgtacaagcagatcgttattgcggtgggc
gagggcgccaaggcttcgctggcggcgttcgatcacctgatccgtacctcggcgccggcc
tga

DBGET integrated database retrieval system