KEGG   Pseudomonas entomophila: PSEEN2769Help
Entry
PSEEN2769         CDS       T00362                                 

Definition
(GenBank) putative metallothionein
Organism
pen  Pseudomonas entomophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallothio_Pro Copper-fist
Motif
Other DBs
NCBI-ProteinID: CAK15553
UniProt: Q1I9X0
LinkDB All DBs
Position
2907798..2908028
Genome map
AA seq 76 aa AA seqDB search
MNEQRCACNHCSCTVDANAVVQDGKAYCCEACATGHRNGEPCRMADCKCGELTQPKESTV
DNALDETFPASDPISP
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcaacgctgtgcctgcaaccactgctcctgcaccgtggatgccaatgccgtg
gtccaggatggcaaggcttattgctgcgaagcctgcgcgacagggcatcgcaatggtgag
ccttgccgtatggcggactgtaaatgtggcgagctgacccaaccgaaggagagcactgtc
gataacgcattggatgaaacgttcccggcgagtgatcccatttcgccgtga

DBGET integrated database retrieval system