Pseudomonas entomophila: PSEEN3809 Help Entry PSEEN3809         CDS       T00362                                  Name (GenBank) conserved hypothetical protein   KO K20976   histidine phosphotransfer protein HptB Organism pen  Pseudomonas entomophila Pathway pen02020   Two-component system pen02025   Biofilm formation - Pseudomonas aeruginosa Brite KEGG Orthology (KO) [BR:pen00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     PSEEN3809  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     PSEEN3809  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02022 Two-component system [BR:pen02022]     PSEEN3809 Two-component system [BR:pen02022]  Other families   SagS-HptB-HsbR (swarming activity and biofilm formation)    PSEEN3809 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hpt Motif Other DBs NCBI-ProteinID:  CAK16525 UniProt:  Q1I757 LinkDB All DBs Position complement(4087728..4088024) Genome browser AA seq 98 aa AA seqDB search MEDGYPQLLETFLEDSERRLNQLHEAKDAGELGMAAHSFKGSSSNMGAVGLAGLCQQLED RVRQVPLYGIEDLINRIDQEYLEVQRFYRNERQRISAG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggaggacggctacccgcaattgctggaaaccttcctcgaggactccgagcgacgtctc aatcagctgcacgaagccaaggatgccggtgaactcgggatggcggcgcacagcttcaag ggcagcagcagcaacatgggggccgtgggcctggccggtctctgccagcaactggaggat cgcgtgcgccaggtgccgctgtacggtatcgaagacctgatcaatcgcatcgaccaggag tacctggaggtgcagcgcttctatcggaacgagcggcaacggatttccgcaggttag

DBGET integrated database retrieval system