KEGG   Pseudomonas entomophila: PSEEN4483Help
Entry
PSEEN4483         CDS       T00362                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pen  Pseudomonas entomophila
Pathway
pen00473  D-Alanine metabolism
pen00550  Peptidoglycan biosynthesis
pen01100  Metabolic pathways
pen01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSEEN4483 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSEEN4483 (ddlB)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PSEEN4483 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pen01011]
    PSEEN4483 (ddlB)
Enzymes [BR:pen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PSEEN4483 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:pen01011]
 Precursor biosynthesis
  Amino acid ligase
   PSEEN4483 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp ATP-grasp_3 RimK ATPgrasp_YheCD ATP-grasp_5 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: CAK17165
UniProt: Q1I5C0
LinkDB All DBs
Position
complement(4796524..4797480)
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAVIEALTSAGVDVVAIDVGDD
LLARLQNEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASEQDCVAASAELGFPLIVKPAHEGSSIGMAKVNSEQELVAAWKDAAK
YDSQVLVEQWIHGPEFTIAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSV
KEQELIDLTARACDAIGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILADSVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaagctgcactccaccctcgacgtcaaggccttcggccgtgtt
gccgtgctctacggcggcaagagcgccgaacgtgaggtttcgctgaaatccggtgcggcg
gtgatcgaagcgctgaccagcgccggtgtcgacgtggtcgccatcgatgtgggtgacgac
ctgctggcgcgcctgcagaacgaaaagatcgaccgcgccttcatcatcctccacggccgt
ggcggtgaagacggcagcatgcagggcctgctcgagtgcctggggatcccctacaccggc
agcggcatccttgcctcggcactggccatggacaagctgcgcaccaagcaggtgtggcag
agcctgggtatccccacgccacgccacgcggtgctggccagcgaacaggactgtgttgcc
gccagcgcggaactgggcttcccgttgatcgtcaaacctgcccatgaaggttcgagtatc
ggcatggccaaggtgaacagcgagcaagagctggtcgccgcctggaaagacgccgcgaag
tacgactcgcaggtactggtcgagcagtggatccatggcccggagttcaccatcgccgta
ctgcgcggccaagtgctgccgccgatcgcgttgggcaccccgcatgtgttctacgactac
gacgccaagtacatcgccaatgacacccagtaccgcatcccgtgcggcctggacagcgtc
aaggagcaagagctgatcgacctgaccgcgcgcgcctgcgatgccatcggcatcgagggt
tggggccggctggacgtgatgcaggacgagcagggccggttctggctgctcgaagtcaac
accgcacctggcatgaccgaccatagcctggtgcccatggcggcccgcgcggccggcctg
gacttccagcagttggtgctggcgatcctggccgacagcgtagcgacgcgaggttaa

DBGET integrated database retrieval system