KEGG   Pseudomonas entomophila: PSEEN4864Help
Entry
PSEEN4864         CDS       T00362                                 

Gene name
purD
Definition
(GenBank) phosphoribosylglycinamide synthase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
pen  Pseudomonas entomophila
Pathway
pen00230  Purine metabolism
pen01100  Metabolic pathways
pen01110  Biosynthesis of secondary metabolites
pen01130  Biosynthesis of antibiotics
Module
pen_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pen00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PSEEN4864 (purD)
Enzymes [BR:pen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     PSEEN4864 (purD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C CPSase_L_D2 ATP-grasp_3 ATP-grasp ATP-grasp_4 RimK ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: CAK17516
UniProt: Q1I4C0
LinkDB All DBs
Position
5171554..5172849
Genome map
AA seq 431 aa AA seqDB search
MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVTALEQLADFA
EKNVDLTIVGPEAPLVLGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHKIPTAD
YQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLAGNAFGEAG
SRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVTA
DVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVML
RLESSLVLLVEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYNKGDVISGLDAAAKLE
GKVFHAGTALKDGQVATAGGRVLCATAMGDTVEAAQQQAYRLAKEVTWNGSFHRTDIGYR
AIARERGEHQQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttgatcatcggcagcggcggccgcgagcacgccctggcctggaaagtcgcc
caggacccccgcgtcgagaaagtcttcgtcgccccgggcaacgctggcaccgccattgaa
gccaagtgcgagaacgtcgccatcgacgttaccgccctggaacaactggccgatttcgcc
gagaagaacgtcgacctgaccatcgtcggcccggaagcaccgctggtgctcggcgtggtc
gacctgttccgcagccgtggcctggactgcttcggcccgaccaagggcgcggcccagctg
gaaggttcaaaagccttcaccaaggacttcctggctcgccacaagatccccaccgccgac
taccagaacttcaccgagatcgagccggccctggcctacctgcgtgaaaaaggcgccccc
atcgtgatcaaggccgacggcctggccgcgggcaagggcgtgatcgtcgccatgaccctg
caggaagccgaagacgccgtgcgcgacatgctcgccggcaacgccttcggtgaggccggt
tcgcgcgtggtcatcgaggaattcctcgacggcgaggaagccagcttcatcgtcatggtc
gacggccacaacgtactgcccatggccaccagccaggaccacaagcgcgtcggcgacaag
gacaccggcccgaacaccggcggcatgggcgcctactcgcccgcaccggtagtcaccgca
gacgtgcaccagcgtgtgatggaccaggtgatctggccgaccgtgcgcggcatggccgag
gaaggcaacgtctataccggcttcctctacgcaggcctgatgatcgacaaggcgggcaat
cccaaggtcatcgagttcaactgccgcttcggcgaccccgagacgcaaccggtcatgctg
cgcctggagtcgagcctggtgctgctggtggaagccgcattcgccaaggccctggacaag
gtcgaagcccagtgggatccgcgcccgagcctgggcgtggtgctggccgccggtggctac
ccgggtgactacaataaaggcgacgtgatcagtggtctggacgctgccgccaagctagaa
ggcaaggtgttccacgccggtaccgcactgaaggacggccaggtagccaccgcaggtggt
cgtgtgctctgcgccactgccatgggtgacaccgtcgaggccgcccagcagcaggcctac
cgcctggccaaggaagtgacctggaacggcagcttccaccgtaccgacatcggctaccgg
gccatcgcccgcgagcgcggtgaacaccagcagtaa

DBGET integrated database retrieval system