KEGG   Prevotella enoeca: AS203_00705Help
Entry
AS203_00705       CDS       T04173                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
peo  Prevotella enoeca
Brite
Translation factors [BR:peo03012]
 Eukaryotic Type
  Elongation factors
   AS203_00705 (tuf)
 Prokaryotic Type
   AS203_00705 (tuf)
Mitochondrial biogenesis [BR:peo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AS203_00705 (tuf)
Exosome [BR:peo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AS203_00705 (tuf)
  Exosomal proteins of breast cancer cells
   AS203_00705 (tuf)
  Exosomal proteins of colorectal cancer cells
   AS203_00705 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase ATP_bind_1 cobW
Motif
Other DBs
NCBI-ProteinID: ALO47811
UniProt: A0A0S2KI59
LinkDB All DBs
Position
complement(184046..185239)
Genome map
AA seq 397 aa AA seqDB search
MAKETFVRTKPHVNIGTIGHVDHGKTTLTAAISKVLHEKGFGAEDVKSFDQIDNAPEEKE
RGITINTAHIEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTRE
HVLLARQVNVPRLVVFLNKCDMVEDEEMLELVEMEMRELLDQYEYDGENTPIIRGSALGA
LNGVEKWVDSVMQLMDAVDTWIPLPPREVDKPFLMPVEDVFSITGRGTVATGRIETGRIK
VGDEVELLGLGEDKKSVVTGVEMFRKLLDEGEAGDNVGLLLRGIDKAEIKRGMVLCHPGQ
IKPFKKFKASIYVLKKEEGGRHTPFGNKYRPQFYLRTMDCTGEISLPEGVEMVMPGDNVE
ITVDLIYAVALNVGLRFAIREGGRTVGAGQITEIIDD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagacattcgtgcgtaccaaaccgcacgttaacatcggtactattggtcac
gttgaccacggtaagactactttgacggctgccatctctaaggttcttcacgagaagggt
ttcggcgcggaagatgttaagtctttcgatcagatcgacaacgctcccgaggagaaagag
cgtggtattaccatcaataccgcacacattgagtatgaaacagctaatcgtcactatgca
cacgttgactgtccgggacacgccgactatgtgaaaaacatggttactggtgctgctcag
atggacggtgcaatcatcgtggtagctgcaacggacggtcctatgcctcagacacgtgaa
cacgtgttgctcgcacgtcaggtgaacgttcctcgtttggttgttttcctgaacaagtgc
gatatggttgaggatgaggaaatgctcgaactcgttgaaatggaaatgcgcgaacttctc
gatcagtatgagtacgatggcgagaataccccaatcattcgcggttctgcactcggtgca
ttgaacggtgttgaaaaatgggttgactccgtaatgcaattgatggatgctgttgacact
tggattcctctgcctccgcgtgaagtggacaaacctttcttaatgcctgttgaggatgta
ttctctatcacgggtcgtggtactgttgctacgggtcgtattgagacaggtcgaatcaag
gtcggtgatgaagttgaactcctcggacttggtgaagacaagaagtctgttgttaccggt
gtcgagatgttccgtaagcttcttgatgagggtgaagcaggtgataacgtaggtctgttg
cttcgcggtatagataaggctgaaatcaaacgtggtatggtgctttgccatccgggtcag
atcaaacctttcaagaagttcaaggcttctatctatgtgttgaagaaagaggaaggcggt
cgtcatacaccgttcggaaacaagtatcgtcctcagttctatctccgcacaatggactgc
accggtgagatttctctgcccgaaggcgtagagatggttatgccgggtgataatgtagag
atcactgtcgatctgatttatgcagttgcgctgaatgtcggtctgcgtttcgctatccgc
gaaggtggccgcacggttggtgcaggtcagatcaccgagatcatcgacgattaa

DBGET integrated database retrieval system