KEGG   Prevotella enoeca: AS203_00965Help
Entry
AS203_00965       CDS       T04173                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
peo  Prevotella enoeca
Pathway
peo00500  Starch and sucrose metabolism
peo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:peo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AS203_00965
Enzymes [BR:peo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AS203_00965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ALO47848
UniProt: A0A0S2KHS4
LinkDB All DBs
Position
complement(234573..236663)
Genome map
AA seq 696 aa AA seqDB search
MKRFLLTASLFLGLAFTLNAAEMASPNGAIKVNFELNNGVPTYSVTFRGKMMIKPSRLGY
ELSGAENLLDGFTLLGQETARQDETWKPVWGENSEIRNHYTELLVKLVQPSTDRYMNIRF
RVYDEGVGLRYEFPQKGKLNHFVVKDERTEFAMTGDHIAWWIPGDYDTQEYEYTRSKLSE
IRSLLTKAVTDNLSQTTFSTTGVQTSLMLKTADGIYMNLHEAALVNYPAMHLNLDDKQMV
FTSWLTPDAQGKKGYLQTPLNSPWRTIMITDDARKVLASNLILNLNDPCALSDTSWIHPV
KYVGVWWEMISGKSEWAYTHQYPTVKLGETDYIHATPSGKHGANNANVRRYIDFASANGF
DAVLVEGWNIGWEDWAGNSKEHVFDFLTPYPDFDIKALNDYAHSKGVKLIMHHETSSSIM
NYEKYMDRAYQLMNTYGYDAVKSGYVGNIIPRGEHHYSQIEINHYLHAIKRAADYHIMVN
AHEAVRPTGLCRTYPNLIGNESARGTEYQAFGGTKPGHTAILPFTRLQGGPMDYTPGIFE
MDCANGSHCNSTICGQLALYVTMYSPLQMAADFPENYEKHPDAFQFIKDVAIDWDKSIYL
EAEPMEYISVARKAKGTDNWFVGGVTGKQAHRSDITFHFLDKSRKYEATIYRDGTDADYK
TRPQSYKIEKLTVTAKTKLSINSVPGGGYAISLIAK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgattccttttaacggccagcctcttcttaggattggctttcaccttgaatgca
gccgaaatggcctccccaaacggagcgataaaggtgaattttgaactcaataacggtgtg
ccgacttacagcgtgacctttcgtggcaagatgatgattaagcccagccgactgggttac
gagctttcgggagctgaaaacttgctcgatggctttacacttttgggtcaggagacagcc
cgacaagatgaaacctggaagccggtatggggtgaaaacagcgagattcgcaatcattac
accgaactcttggtgaaactcgttcagccatctaccgatcgttatatgaacattcggttc
cgggtgtacgatgaaggagtaggtttgcgctacgaattcccgcaaaaaggcaagctcaat
cacttcgtcgtgaaagacgaacgcaccgagtttgcaatgacaggagaccatattgcgtgg
tggataccgggcgactatgacacgcaagagtatgaatacacccgctcgaaactgagtgag
atacgcagtttgttgactaaagccgtgacggataacctctcacagaccaccttttcaacc
acaggcgtacagacatcgttgatgttgaagaccgccgacggtatctatatgaatctgcac
gaggctgcattggtcaattatccggctatgcatctcaatctcgacgataagcagatggtc
ttcacttcgtggttgacgcccgacgcccaaggcaagaaaggttacttacagacacctctc
aacagtccgtggcgtaccattatgatcaccgatgacgcccgaaaggtgttggcttccaac
ctcattctcaatcttaacgatccctgtgcactcagcgatacgtcgtggattcaccctgta
aagtatgtcggtgtgtggtgggaaatgatttccggaaagagcgaatgggcttatacccat
caatatccgacggtgaaactcggtgaaactgactacattcacgccactccttcgggcaaa
catggagccaataatgccaatgttcgccgttacatcgacttcgcttcggccaacggtttc
gatgcagtcttagtcgaaggatggaacatcggctgggaggattgggccggaaactccaag
gaacacgtgttcgatttcctcacaccatatccagatttcgatatcaaagcactcaacgac
tatgcccattccaaaggagttaaattgatcatgcaccacgaaacctcgtcatccattatg
aattacgagaagtatatggaccgagcttatcagctgatgaatacttatggttacgacgct
gttaagagtggatatgtcggaaacattattccgagaggcgaacaccattacagtcagata
gagattaatcactatttgcacgctattaagcgtgcagccgactatcatattatggtcaac
gcacatgaagctgtgcgacccaccgggctgtgtcgcacttatccaaacctgatcggcaat
gagagcgcacgcggaaccgagtaccaagccttcgggggaactaaacccgggcacactgcc
atcttgccgttcacgcgcttgcaaggcggaccgatggattacacgccgggtatcttcgag
atggattgtgccaatggatcgcattgcaattcgacgatctgcggccaacttgccctttat
gtcacgatgtacagcccgttgcagatggctgccgacttccctgagaactacgagaagcat
ccggatgctttccaattcatcaaggacgtggccatagattgggacaaatcgatttacctc
gaagccgagcccatggagtatatctccgttgcccgcaaggccaaaggcacagacaactgg
ttcgttggcggtgtaacgggaaagcaagcccatcgctctgacatcacgttccacttcttg
gataaaagtcggaagtatgaagccaccatttatcgagacggtaccgacgccgattacaag
actcggccgcagtcttacaagattgagaagcttacggtgacagccaagaccaagctctcc
atcaacagtgttcccggtggcggttatgctatttcgctgattgcgaaataa

DBGET integrated database retrieval system