KEGG   Prevotella enoeca: AS203_11690Help
Entry
AS203_11690       CDS       T04173                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
peo  Prevotella enoeca
Brite
KEGG Orthology (KO) [BR:peo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AS203_11690
Enzymes [BR:peo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AS203_11690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored Thi4 NAD_binding_8 DAO AlaDh_PNT_C Lycopene_cycl FAD_binding_3 Glutaredoxin DSBA
Motif
Other DBs
NCBI-ProteinID: ALO49662
UniProt: A0A0S2KNG3
LinkDB All DBs
Position
2729080..2730645
Genome map
AA seq 521 aa AA seqDB search
MLDTNILSQVRDLFQGLQSNYTLAAVIGSDNDKAVEMREFLNDFASTSDRLTVTFVEDEF
HQLAFSLLKDGQEIGIRFRGIPNGHEFTSLLLAVLNADGQGKNLPDEAISCRIAAIQDEI
KFETYVSLTCTNCPDVVQALNVMALLNPSISNEMIDGALFQDEVSRRNIQGVPSVFVNGE
PFHTGRGDLGELLQKLEDRMGSSETAIGEPIERTYDVIVLGGGPAGASAAIYSARKGLRV
GIIAERIGGQVKDTVGIENLISVPQTTGAQLAANLKEHIGRYEIDVFENRKIDRVALQGT
QKRVFVRGGEEFVSPAVILATGAGWRRLNVEDEARYIGHGVHFCPHCDGPFYRNKDVAVI
GGGNSGIEAAIDLAGICRNVTVLEFADKLGADTVLQEKARSLSNVEIFVSSQTTAVLGDG
EKLTALCVKDRNTDAEREIKLDGVFVQIGLSPNSDLFNGQLELTAHREVKIDETNRTSLP
GVYAAGDVSSVPYKQIIIAMGGGAKAALSAFEDRIRGVIAS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagataccaatattttaagtcaagttcgcgacctgtttcagggcttgcaatcaaac
tatacattagctgccgtcatcggttctgataatgacaaggcagtggaaatgcgcgaattt
ctcaatgatttcgcatcgacgtccgaccgactcacggttactttcgtcgaagatgaattt
catcagttggccttttcgttattgaaagacggacaagagataggtattcgcttccgtgga
atccctaacgggcacgagtttacatcgcttttgttagctgtactcaatgcagacggacag
ggaaagaatcttcccgatgaggccattagttgtcggatagcagctattcaggatgagata
aagtttgaaacgtatgtttcactcacctgcacgaattgtcctgatgttgtgcaagcactc
aatgtgatggcgcttctcaatccttcgatcagcaatgaaatgattgacggagctttgttt
caagacgaagtgagtcggcggaacatacaaggcgtaccctcggtgtttgttaacggcgaa
ccgtttcatacgggtcgcggtgatttaggtgagcttttgcagaaattagaagaccgaatg
ggcagttcggaaactgctatcggcgaaccgatcgaacgtacttatgatgtcattgtactc
ggaggaggacctgccggagcatcggccgctatttattcggctcgcaaaggtctgcgcgtc
ggtatcattgcagaacgcatcggaggtcaggtgaaagacacggtaggtattgaaaatctc
atctccgtgcctcaaacgacaggtgcacaattagctgccaatctcaaagaacatatcggt
cgttatgaaatcgatgtctttgaaaatcgaaaaatagaccgtgtagcgctgcaaggaacg
cagaaacgtgtattcgttcgtggcggcgaggaatttgtttcacccgcagtcatccttgcg
acaggtgccggttggcgtcggttgaatgtcgaagatgaagctcgttatatcggtcatggt
gtgcatttctgtccccattgcgacggtcctttttatcggaataaagatgtggcagtcatt
gggggcggtaattcgggtatcgaagcagctatcgatttggccggaatctgtcggaatgtc
accgtgttggagtttgccgataagctcggtgccgacactgttttgcaggagaaagcccgc
agtctgagtaatgtagagatcttcgtttcatcgcagacgactgccgtactgggtgatgga
gaaaagttgacagccctttgtgtgaaggatcgtaacaccgatgcagagcgtgaaatcaaa
ctggatggcgtgtttgtacagataggattgagtcccaacagcgacttattcaatgggcaa
ttggaactgactgctcatcgggaagtaaagatcgacgagaccaaccgcacatcattgcca
ggtgtctatgctgccggcgatgtgtcgagtgttccttacaagcagattatcattgctatg
ggcggaggtgccaaggctgctctctctgcttttgaagaccgcatccgcggcgttatagcc
tcttaa

DBGET integrated database retrieval system