KEGG   Pedobacter sp. PACM 27299: AQ505_00625Help
Entry
AQ505_00625       CDS       T04140                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pep  Pedobacter sp. PACM 27299
Pathway
pep00620  Pyruvate metabolism
pep00680  Methane metabolism
pep01100  Metabolic pathways
pep01120  Microbial metabolism in diverse environments
pep01200  Carbon metabolism
Module
pep_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AQ505_00625
  09102 Energy metabolism
   00680 Methane metabolism
    AQ505_00625
Enzymes [BR:pep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AQ505_00625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 PspB
Motif
Other DBs
NCBI-ProteinID: ALL04127
UniProt: A0A0P0NAL3
LinkDB All DBs
Position
complement(169447..172038)
Genome map
AA seq 863 aa AA seqDB search
MMQKQRAKGQRESVFNNEVVSRFELYNSLFLTLPFYRVKDTGTLLPLFIKYCEDGVKNHE
TPAGIINAFFEKYTQNNSKKDIIDLLFRFIQYIERQVVLFDAVEDASFNKLNAEEEHSAL
LVYLKKAVDNPALTEKIEKLIEEFSLRLVLTAHPTQFYPGSVLSIITDLTTAIKTNDIST
INQLLQQLGKTPFFNKKSPTPVDEALSLAWYLENVFYFAAANIQSEIDQSLNDYNLESKK
IIELGFWPGGDRDGNPNVHADSTIQVSKMLRQILFRCYYRDFRNLKRRITFRGVEENIAL
VQETLYAQAFNPNIATEDISASLIEILNKIKTTLLEDHDGLFADLVSDLIRKMELYGSHF
ASLDIRQDSRVLRDVHTYCRQSKPLTTLYPENYENLNEQEKIKAMIFKSAKVNYTEPANS
LTEDTLQTIAEIKQIQQINGEMACHRFIISNCQQASDILQLIELFLYNGWTEDELTIDFV
PLFETVHDLADASEIMETLYSHPFYKKHLQNRGGKQHIMLGFSDSTKDGGYLMANWSIFN
AKVALTETADKHNIQLAFFDGRGGPPSRGGGKTHRFYASMGKEIANKNIQLTVQGQSISS
QYGSIDSAEFNMEQLINAGISAGMKEKHNILLDPLHKNLLDEMATESFEAFVSLRKHPLF
LSYLEKFSPLTLLSKITISSRPVKRNSGEALKLEDLRAISFVTAWSQLKQNIPGFYGIGT
ALKSQLDLGNWDKVVKTYQESGYFKTIIDNCMMSMSKADFAITAHFANDTEYGAFWTTLY
NEFELSKELLLKLSGHESLMENYPVEKRSISVREKIVLPLVLIQHYALEQLQNDNISEEE
QQSLEKLSIRTVYGIVNAGRNLA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagaaacaacgcgctaaaggccagagagagtccgtattcaacaatgaggttgtc
tccagatttgaactttacaacagccttttccttacccttcccttctacagagtaaaagat
accggaactttgcttccgctcttcattaagtattgcgaagatggtgtcaagaaccacgaa
acgccagcaggaatcattaatgcattttttgaaaagtatacccaaaataattctaagaaa
gacattatcgacctacttttccgcttcattcaatacatcgaacgccaggtggtattgttt
gatgctgttgaagatgcctccttcaataaactaaatgcagaagaagaacacagtgcttta
cttgtttatctgaagaaggcggttgacaatccagccttaaccgaaaaaattgagaaacta
attgaagagttttccctgagactggtactgaccgcccaccctacccagttctatcctgga
agtgtgctatcgatcattaccgacttaaccaccgccattaagacgaatgacatttctacc
atcaatcagctgctgcagcaattgggtaaaacgccattctttaacaaaaaatcacctact
ccagtagatgaagctttgagcctggcctggtacctggaaaatgtattctattttgctgct
gccaatatccaatcggagattgaccaaagcttaaatgattataacctggaatctaaaaaa
atcatcgaacttggcttctggccaggaggcgatcgtgacgggaatcctaatgtgcatgcc
gattctaccattcaggtgtccaaaatgctgcgtcagatccttttcagatgttattacagg
gactttagaaatctgaaacgccgtattacctttagaggtgtagaagaaaatattgcctta
gtacaagaaacgctatacgcacaggcctttaatccaaatattgctacagaagacatttct
gccagcttaattgagatcctgaacaagattaaaaccacgcttttagaagaccatgacggc
ttgtttgccgaccttgtttcagacctgatccgcaagatggagctttacggcagtcacttt
gcctctttagacatccgccaagacagcagggtactaagagatgtacatacttattgccgc
cagagcaagcctttaacgaccctgtatcctgaaaactatgaaaacctaaatgagcaggag
aagatcaaggccatgatctttaaaagtgccaaggtgaattacacggaaccagcaaactct
ttaacggaagataccctgcaaaccatcgcagagatcaagcaaattcagcagatcaatgga
gaaatggcctgtcacaggtttattatcagtaattgccagcaggcgagtgatatcttacag
ctgatcgaactgttcctatataatggctggacagaagatgaactgaccatagatttcgta
cctctttttgaaaccgtacatgaccttgcagatgcttccgaaatcatggaaacgctgtac
agtcacccattctataaaaaacatttacaaaacagaggcggtaaacagcacatcatgctg
ggcttctctgacagtaccaaagacggtggttatttgatggccaactggtctatctttaat
gcgaaagtagcccttactgaaactgccgacaagcataatattcaactggccttctttgat
ggcagaggtggtcctccttccagaggtggtggtaaaacacaccgtttctatgcttctatg
ggtaaggaaattgccaataaaaacatccagttaaccgttcagggtcaaagtatcagctct
caatacggatcgattgacagtgccgaatttaatatggagcaactgatcaatgcggggatt
tctgccggcatgaaggaaaaacacaacatcctgctggatcctttacataaaaacctattg
gatgaaatggctacagaaagctttgaagcctttgtttccttacgtaaacatcctttgttc
ctgagctacctggagaaattctctccgcttaccttattgtctaagattacgatcagcagc
agaccggtaaagagaaattctggagaagcattgaagctcgaagacttaagagccatcagt
ttcgtcaccgcatggagccagctgaagcaaaacataccaggtttttacgggatcggaacc
gcactaaaaagccagttagatcttggaaactgggacaaagtggttaaaacttatcaggaa
tccggctactttaaaaccattatcgacaattgtatgatgtctatgagcaaagccgatttc
gccattactgcccattttgccaatgatacagaatatggcgcattctggactacgctttac
aacgaatttgagctctctaaggagcttttattaaagctgtccggacatgagagtctgatg
gagaattacccagttgagaaacgctctatttccgttagggagaagattgtactgccattg
gtattgatccagcattacgcattagaacagcttcaaaatgacaatatttctgaggaagaa
cagcagtcattagaaaaactatctatcagaaccgtttatggtatcgtaaacgcgggaaga
aacctcgcttaa

DBGET integrated database retrieval system