KEGG   Pedobacter sp. PACM 27299: AQ505_11880Help
Entry
AQ505_11880       CDS       T04140                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pep  Pedobacter sp. PACM 27299
Pathway
pep00564  Glycerophospholipid metabolism
pep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AQ505_11880
Enzymes [BR:pep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AQ505_11880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like GIDA FAD_binding_3 NAD_binding_8 Pyr_redox Thi4 Pyr_redox_3 Lycopene_cycl 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALL06129
UniProt: A0A0P0NG97
LinkDB All DBs
Position
2838101..2839663
Genome map
AA seq 520 aa AA seqDB search
MDRLKLIQNLATGEKWDVVIIGGGATGLGIAMDAATRGYKTLLVEQADFAKGTSSKATKL
VHGGVRYMAQGDLGLVREACHERGLLLKNAPHLTKNESFVIPNYTWFDNIKYTIGLKFYD
LLAGKLSLGASKYINKEKTIAALPSIKREGLKGGVVYHDGQFDDTRLALNIAQTAIENGA
TVLNYMKVEGLLKDNSKKVNGVKVKDIETGNTYDVLGKVVINATGVYVDNILQMDRPEAP
HLVRPSQGVHITLDRSFMEGDNALMIPETDDGRVLFAVPWHDKLIVGTTDTLRDHPELEP
QALDQEIEFILSTAAKYFRKKPTRADVLAVFAGLRPLAAPKQEGSKTKEISRSHKIIVSD
SAMITITGGKWTTFRRMAQDTVDKAIEKGYLPAKPCKTEQLHIHGYVASPDKSDPLHFYG
TDLAGIQKLIQENPALGERLVPAYPYTKAMVVWAVRNEYARRVEDVLGRRFRLLFLDVKA
AIAAAPEVARIIAEELNRDQIWVEKEVEDFKKLAKTYTIF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggacagacttaaattgatacagaatctagcaaccggcgaaaaatgggacgtggtcatc
attggcgggggagctacaggtttggggatcgcaatggacgcggctacacgtggttataaa
acgttattagtggaacaggcagattttgctaaaggaacctctagtaaagcaaccaaatta
gtgcacggcggtgttcgttatatggctcagggagatctcggcctggtgcgtgaagcttgt
catgaaagaggtttgctattgaaaaatgcccctcatctgactaaaaatgaatcattcgtc
attccaaattatacctggttcgacaatattaaatataccataggattgaagttttacgac
ctgctggcaggtaaactcagccttggtgcctcaaaatatatcaataaggaaaagaccatt
gccgcattaccttctattaaaagagaaggattaaaaggtggagtggtttaccatgacggt
cagtttgatgacacccgacttgccttaaatatcgcacagactgcaatagaaaatggcgca
acggtactcaactacatgaaagtagaaggtttactgaaagacaacagtaagaaagtaaac
ggcgtaaaagtgaaagatattgaaaccggaaatacttacgatgtcctgggaaaagtggtg
atcaatgcaaccggtgtatatgtagataatattctgcaaatggacagaccggaagcacca
catctggtacgcccaagtcagggggtgcatattacgcttgatcgttcttttatggaagga
gataatgcgctgatgattcctgaaactgacgatggaagggtgctatttgcagtaccttgg
catgataaactgattgtaggaactacagatacactaagagatcatccggagctagagcct
caggccttagatcaggaaatcgaatttatcctttctacagcagcaaaatactttaggaaa
aaaccaacccgtgcggatgtacttgctgtttttgcaggtttacgtccattggcagcccca
aaacaggaaggctcaaaaacaaaagaaatttccagaagtcataaaatcatcgtttcagac
tctgcaatgatcaccatcaccggtggtaaatggactacctttagaaggatggctcaggat
acagtagacaaagcgattgaaaaaggatatctgccagcaaaaccttgtaaaacagaacag
cttcacattcatgggtatgtggcttctccagataaatcagatccacttcatttttatgga
actgatcttgcagggatccaaaagctgatacaggaaaatcctgcacttggggaaagattg
gttccagcctatccatatacgaaagcaatggtggtatgggccgttagaaatgaatatgcg
cgaagggtagaagatgtgctgggacgtcgtttcagactgctgttcctggacgttaaagca
gccattgcagcagcaccggaagtggccagaatcattgctgaagagttaaaccgcgatcag
atatgggtagagaaagaagtggaggactttaagaaactcgctaaaacctacaccatattt
taa

DBGET integrated database retrieval system