KEGG   Pedobacter sp. PACM 27299: AQ505_15075Help
Entry
AQ505_15075       CDS       T04140                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pep  Pedobacter sp. PACM 27299
Pathway
pep00500  Starch and sucrose metabolism
pep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AQ505_15075
Enzymes [BR:pep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AQ505_15075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ALL08812
UniProt: A0A0P0NNB8
LinkDB All DBs
Position
complement(3582468..3584582)
Genome map
AA seq 704 aa AA seqDB search
MTRISKLILMICFCYSTSALKAQELKSPDKNLTLKFSLGTAGTPEYELSYKGKSVIKPSK
LGFQLKNADDLLNGFEIADTKQSTFDESWNPVWGEVKTIRNHYNELAVTIKQAASDRFII
VRFRLFNDGLGFRYEFPTQKNLNYFTVKEEKTQFALSGDHKAFWLPGDYDTQEYSTTTSN
LSEVRGKMKAAVTPNVSQKTFSETGLQTPLMMKSKDGLYINIHEAALINYSTMSLELNDQ
NMVLESVLTPDAIGDKGYLQAPTQSPWRTVIVSDKAGDILLSKTILNLNEPTKFKDVSWI
KPIKYVGVWWEMITGKSTWAYNDLDNVQLGITDYSKTTPNGKHAANTKRVKEYIDFAAEN
GLDAVLVEGWNEGWEDWFGKTKDYVFDFVTPYPDFDVKELHRYAASKNVKIMMHHETSSS
VRNYERHLDTAYKFMVDNGYSAVKSGYVGNIIPRGEHHYGQWLVNHYQYAIEKAAEYKIM
VNAHEAVRPTGLSRTFPNLLANESARGTEYEAFGGNNADHTTILPFTRLMGGPMDYTPGI
FETKVSAYNPENNSFVHSTLARQLALYVTMYSPLQMAADLPETYHKFKDAFQFIKDVAVD
WDDTKVLEAEPGDYITFARKAKGTNNWFVGSTCDEQGRVSKLNLDFLDAGKKYTATIYSD
AKDAHYEKNPQAYVIKKMKVSKGTKLTQFCAPGGGYAISIIEVK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggatttctaagttaattcttatgatttgtttctgttacagcaccagcgcccta
aaggcacaggagttaaaatcacccgataaaaacctgactttaaagttcagcctcggcact
gccggaacaccagaatacgagctttcctataaaggaaaaagcgtgattaagcctagtaaa
ctgggttttcaattgaaaaacgcagatgatctattgaacggctttgaaatcgctgatact
aaacaaagtacttttgacgaaagctggaacccggtttggggtgaagttaaaaccatccgt
aaccattacaatgagcttgcggtaacgattaaacaagctgccagcgaccgctttatcatt
gtccgctttcgcttgtttaatgacggtttgggattccgttatgaattccctacacagaaa
aacctaaactatttcactgtaaaagaagaaaaaacacaatttgctttatctggagaccat
aaagccttctggcttcctggcgattatgatacgcaggaatacagcaccacaacctctaat
ctttctgaagttcgcggtaaaatgaaagcagcggtaacgcctaacgtttctcaaaagacg
ttttcagaaacaggcctgcaaacgcctttaatgatgaaaagcaaggacggactgtacatt
aatatccatgaagccgcattgattaattattctacgatgtctttagagctgaatgatcag
aatatggtattggaatctgtattgacaccggatgcaattggcgataaaggatacttgcag
gcaccaacacagtcgccatggagaacggttattgtgagcgataaagcgggtgatattcta
ttgtctaaaacgatccttaacttaaatgaacctactaaatttaaagatgtttcctggatt
aagccgattaaatatgttggcgtatggtgggaaatgatcaccgggaaaagtacctgggcc
tataatgacctggacaatgtgcagttggggataaccgattacagcaagactacaccaaat
ggcaaacatgctgcaaatacgaagcgcgtgaaagaatacattgattttgcagcagaaaat
ggtttagatgcggtattggtagaaggctggaatgaaggatgggaagattggtttggaaaa
actaaagactatgttttcgacttcgttacgccttacccggatttcgatgtgaaggaatta
caccgctatgcggccagtaaaaatgtaaaaattatgatgcaccatgaaacatcctcctct
gtaaggaattatgagcgtcatctggatacagcgtacaagttcatggtcgataacggctat
agcgcagtaaaaagtggttacgttggtaacattatccctagaggggagcaccattacgga
caatggctggtgaatcattaccaatatgccatagaaaaagctgcggaatataaaataatg
gtgaatgcacatgaggcggtaaggcctacaggattgagccgcacctttccgaatttacta
gccaatgaatctgcaagaggtacagaatacgaagcttttgggggaaataatgccgatcac
accacgatattgccattcaccagattaatgggaggcccgatggattataccccagggatc
tttgaaacgaaagtaagtgcctataatccggaaaacaattccttcgttcatagcacgctt
gcccgtcagctagcactttatgtaacgatgtatagtccgctgcaaatggccgcagattta
cctgaaacttatcacaagttcaaagatgcttttcagttcatcaaagatgtagcggtagat
tgggacgatacgaaagtacttgaagctgaacctggtgattacatcactttcgccagaaaa
gctaaaggaaccaacaactggtttgtgggtagcacctgcgatgaacaaggccgtgtttct
aagctaaatcttgacttcctggatgctggtaaaaaatatacagctaccatctattcagat
gcaaaagatgctcattatgagaaaaatccgcaggcttatgtgattaaaaagatgaaggtg
agtaaaggaactaaactaacgcagttttgtgctcctggcggaggctatgccatcagcatt
attgaggttaaataa

DBGET integrated database retrieval system