KEGG   Pedobacter sp. PACM 27299: AQ505_21600Help
Entry
AQ505_21600       CDS       T04140                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pep  Pedobacter sp. PACM 27299
Pathway
pep03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pep00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AQ505_21600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pep03400]
    AQ505_21600
Enzymes [BR:pep01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AQ505_21600
DNA repair and recombination proteins [BR:pep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AQ505_21600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ALL07859
UniProt: A0A0P0NL85
LinkDB All DBs
Position
complement(5133321..5136071)
Genome map
AA seq 916 aa AA seqDB search
MSLTEYEKKRSFADTPEPQGGKGTGKSLRFVIQKHDASHLHYDFRLEMDGVLKSWAVPKG
PAMDPEIKRLAMMVEDHPYDYRNFEGIIPKGQYGGGTVIVWDEGTYVPFEPETDDLKKQE
KQLLHQLHSGKLKFILSGEKLKGAFALIKAYGKGENTWLLMKLEDKYAQTEDILLKDKSV
ISRKSIAQMEKQPDRVYGKAKPPKAKPSDPKPEKISKALNKEAKTILSAGKKLLSLVKKG
TKAPFFDHVQPMLATLVDEAFDEPGWLYEIKWDGYRALAFMQDSKIELKSRNDKPYNERF
YPIYEALKEWGVNAVLDGEVLVLNEKGTANFGALQNWHNETDGALRYYVFDILWYDGYDL
RGLPLVDRKAILAEIIPASSLILLSKDFETSGIDFLEAAKRAGLEGIMAKRMDSKYHTGN
RTQDWLKIKANHRQEVVIGGYTRNEDSPKPFSSLLVGVFEKGKLNYIGKIGTGFSVKTQQ
EMLAQFEPLVIDKSPFATKPDVNKTSPFRYDPLNATATWLKPKLICEVSFAELTADGLMR
HPSFEGMRSDKDPKAVLLEAAAHPDTLIYKNIMEAAKKNISKKKSKEKDKNSILDTPKAE
GANILLAAEEETQVKKINGHSVKFSNLSKIYWPVEKITKRDMINYYHEMATFILPYLLDR
PQSLNRYPNGITGGSFYQKDVTGKVPEWIKTYLYHAEGDDTDKHFLVGNDEATLLYMASL
GCIELHPWSSTIKKPDHPTWCIIDLDPGKNSFEQVIEAAQVTKAVLDGMGVPSYCKTSGS
TGLHIYIPMANRYTYEQSKEFARVIVTLVNRELPKFTSLERVVANRRGKMYLDFLQNRPQ
ATIAAPYSLRPKPGATVSMPLHWEEVKKGLQMKDFTIFNAVARANEMGDIFRPVLGKGID
LMAVIKNNKSEDLLLE
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttactgaatacgaaaagaaacgttcatttgcagatactcctgaacctcaggga
gggaaaggaactgggaaaagtctgcgttttgtgatccagaagcatgatgcttcccacctt
cattatgattttcgcttagaaatggatggtgtgctgaaaagctgggccgttccaaaaggc
ccggctatggatccggaaatcaagcgtttggcgatgatggtggaagatcatccttatgat
taccggaatttcgaaggcattattcctaaaggacagtatggcggcggaacggtgatcgta
tgggatgagggaacatatgtgccttttgagccggaaaccgatgatctaaaaaaacaggaa
aagcagctgctccatcaattgcatagcggtaaactcaaatttattctcagcggggaaaag
ctgaaaggggcttttgcattgataaaagcttatggtaagggtgaaaatacctggctgctg
atgaagttggaggataaatatgcgcagacggaagatatactgttaaaagataaatcggtg
atttccaggaaaagcattgcacaaatggaaaagcagccggatcgggtatacggaaaagcg
aaacctccgaaagctaagccctcggatcctaaacctgaaaaaataagtaaagccttaaat
aaggaagccaaaaccatcctgtctgctggaaaaaaactgctaagcttagtaaaaaaggga
accaaagcccctttctttgatcatgtgcagcccatgctggctaccctggtggatgaagca
tttgacgagccaggctggctttatgagatcaaatgggatggttatcgtgccctcgctttc
atgcaggattccaaaattgagcttaaatcccgcaatgataaaccttataacgagcggttt
taccccatatatgaggccttgaaagaatggggagtaaatgcagtgctggatggcgaggtc
ctggtgctgaatgaaaaaggtacggctaattttggggccttgcaaaattggcacaatgaa
acagatggagctctgaggtattacgttttcgatatcttatggtatgatggttatgattta
agagggcttccgctggtggatcgaaaagcaattcttgcagaaattattcccgcttcatcg
ctaattttattgagtaaagattttgaaacttcgggcatcgatttcctggaggctgcgaaa
cgcgccggtctggagggcattatggcgaaacgcatggacagcaagtaccatactggaaat
cgtacgcaggattggctaaagattaaagccaatcatcgacaggaagtcgtaattggcggt
tacactagaaatgaagacagtccgaaacccttcagttctttacttgttggggtatttgaa
aagggaaaattgaactatatcgggaagattggaactggtttcagtgtaaaaacacagcag
gagatgctggcgcagttcgagcccctggtaatagataagagcccctttgcgaccaaacca
gatgtcaataaaaccagtcctttccgatacgatccattgaatgcaacagctacctggttg
aagcctaaactgatttgtgaagtcagctttgctgaactcacagcagatggactgatgagg
cacccttcttttgaaggaatgcgatccgacaaagatccgaaagcggtattactggaagcg
gcagcacatccggacaccctgatttataaaaatataatggaagcagctaagaaaaatata
agcaaaaagaaaagtaaagaaaaagataaaaattccattctggatacccctaaagctgag
ggcgcaaacattttactggctgctgaagaagagacgcaggtaaaaaaaataaacggacac
agtgtaaagttcagtaacctcagcaaaatatattggccagtggaaaagatcaccaagcgg
gatatgatcaattattaccatgaaatggccactttcatattgccttatctgctggatcgg
ccgcaatctttaaatcgttatccaaatgggattacaggaggaagtttttaccagaaggat
gtgacaggaaaagttccggaatggataaaaacctatttgtaccatgcggaaggggatgat
accgacaaacattttttagtgggcaatgatgaggcgacattattgtatatggctagttta
ggttgtattgagctgcatccctggagcagtacgataaaaaagcctgaccatccaacctgg
tgcatcatcgatcttgaccctgggaaaaattcttttgagcaggtaattgaggcagcgcaa
gttactaaagctgttttagacgggatgggagtgccctcatactgtaaaaccagtggatct
acagggctgcacatatacatccccatggccaataggtacacctatgaacagagtaaagaa
tttgccagagttatcgttacactcgttaaccgcgagttgccaaaattcaccagtctggaa
cgggtagttgccaatcggaggggtaaaatgtaccttgacttcttgcaaaacaggccacag
gctaccattgcagcaccttattcccttcgtccgaaacctggggcaaccgtttccatgccc
ttacattgggaggaagtaaaaaaaggcctgcagatgaaagattttaccattttcaatgcg
gtagccagagcaaatgaaatgggcgatatttttaggccggtactgggaaaaggaatcgac
ctaatggcggttattaaaaacaataaaagcgaagacctgttattggagtaa

DBGET integrated database retrieval system