KEGG   Phalaenopsis equestris: 110018174Help
Entry
110018174         CDS       T05601                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
peq  Phalaenopsis equestris
Pathway
peq00010  Glycolysis / Gluconeogenesis
peq00053  Ascorbate and aldarate metabolism
peq00071  Fatty acid degradation
peq00280  Valine, leucine and isoleucine degradation
peq00310  Lysine degradation
peq00330  Arginine and proline metabolism
peq00340  Histidine metabolism
peq00380  Tryptophan metabolism
peq00410  beta-Alanine metabolism
peq00561  Glycerolipid metabolism
peq00620  Pyruvate metabolism
peq00903  Limonene and pinene degradation
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110018174
   00053 Ascorbate and aldarate metabolism
    110018174
   00620 Pyruvate metabolism
    110018174
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110018174
   00561 Glycerolipid metabolism
    110018174
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110018174
   00310 Lysine degradation
    110018174
   00330 Arginine and proline metabolism
    110018174
   00340 Histidine metabolism
    110018174
   00380 Tryptophan metabolism
    110018174
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110018174
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110018174
Enzymes [BR:peq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110018174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110018174
NCBI-ProteinID: XP_020571061
LinkDB All DBs
Position
Unknown
AA seq 540 aa AA seqDB search
MAAAARRIASSIISPSSYSVLRSSSSYLLRGRIAGVSSGIQRLSTAAAALEEPITPPVQV
NYTKLLINGQFVDAVSGKTFPTLDPRTAEVIAHVAEADAEDVDRAVAAARKAFDEGPWPK
MSAYERSRILYRFADLIEKHNDEIAALETWDNGKPYEQAAHGEIPMVARLFRYYAGWADK
IHGMIVPAXHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNSIVLKTAEQTPLSA
LVAAKLLHEAGLPDGVLNVLSGYGPTAGAALASHMDVDKLAFTGSTSTGKVVQEMAARSN
LKPVTLELGGKSPMIIMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEK
AKARALKRVVGDPFKKGVEQGPQIDEEQFNKILHFIKSGVEEGATLVSGGERHGDRGYFI
KPTIFSDVKDGMEIAKHEIFGPVQSILKFSDLNEVIKRSNASAYGLAAGVFTTNLDTANT
LMRALRVGTIWINSFDIFDAAIPFGGFKMSGYGREKGLDSLKNYLQIKAVVTHLKNPAWL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcagcgcggaggattgcatcttctattatctcaccatcttcttactctgtt
cttcgttcttcttcctcttatctgcttcgagggagaattgctggtgtttcttctgggatt
caaaggctcagcactgctgctgctgctttggaagaaccaataacacctccagttcaagtg
aactacactaaacttcttatcaatggccaatttgttgacgcggtatcaggaaagactttc
ccaaccttagatcccagaactgcagaagttatagctcacgtagctgaagcagatgcagaa
gatgttgacagagctgttgcggctgctcgtaaggcattcgatgaaggcccatggccaaag
atgtcagcctatgaaagatcgcgcattttatatcgatttgcagatttgattgagaagcac
aatgatgagattgctgcacttgagacttgggacaatgggaagccttatgagcaggctgcc
catggtgagatcccaatggttgctcgtttgtttagatattatgcaggttgggcagataaa
atacatggaatgattgttcctgctnngcatgtgcaagtattgcatgaacctattggtgtt
gcaggccaaataattccatggaattttcctcttctcatgtttgcttggaaggttgggcca
gcgcttgcatgtgggaattcaattgtgctgaagactgcagagcagactccattatctgca
ttagtagcagctaaattactacatgaggcaggcctccctgatggtgtgcttaatgtactc
tctggatatggcccaaccgctggtgctgctcttgctagtcacatggatgttgataagctt
gcctttactggctcaactagtacaggaaaggttgttcaggaaatggctgcaagaagcaac
cttaaaccagtgactttagagcttgggggtaaatctcccatgattattatggatgatgcc
gatattgaccaagcagtggagcttgcccattttgctttgttcttcaatcagggacaatgt
tgctgtgctggctcacgtacttttgttcatgagcgcatatacgatgaatttgtggagaaa
gcaaaggctagagctttaaagcgtgtcgtgggtgacccattcaagaagggtgtggagcaa
ggccctcagattgatgaggagcaattcaacaagatcctgcacttcataaagtctggggtt
gaagaaggggctacacttgtttctggaggtgagagacacggtgaccggggatatttcatt
aaacctaccattttttcagatgtcaaggatggaatggagatagcaaagcatgagatcttc
gggccagttcaatcgatcttgaaattttcagatcttaacgaggtaattaaaagatcaaat
gcgagtgcttacgggttggctgcaggagtcttcaccacaaacttggacactgctaatacc
ctaatgagggctttgagagttgggactatatggatcaacagcttcgatatcttcgacgcg
gcgataccgtttggtgggtttaagatgagcggctatggccgcgaaaagggtttggatagc
ctcaaaaactatctgcagattaaggctgttgttactcacctcaagaaccctgcatggttg
taa

DBGET integrated database retrieval system