KEGG   Phalaenopsis equestris: 110021152Help
Entry
110021152         CDS       T05601                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
peq  Phalaenopsis equestris
Pathway
peq00010  Glycolysis / Gluconeogenesis
peq00051  Fructose and mannose metabolism
peq00052  Galactose metabolism
peq00500  Starch and sucrose metabolism
peq00520  Amino sugar and nucleotide sugar metabolism
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
peq01200  Carbon metabolism
Module
peq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
peq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110021152
   00051 Fructose and mannose metabolism
    110021152
   00052 Galactose metabolism
    110021152
   00500 Starch and sucrose metabolism
    110021152
   00520 Amino sugar and nucleotide sugar metabolism
    110021152
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110021152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:peq04131]
    110021152
Enzymes [BR:peq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110021152
Membrane trafficking [BR:peq04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110021152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110021152
NCBI-ProteinID: XP_020575190
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MRKVVIGSVVIGAATACAVAALIVKHRMKKSGWWAKVEAIVMDFEEKCATPIGKLRQVAD
AMMVEMHAGLASEGGSKLKMLISYVDNLPKGDEKGLFYALDLGGTNFRVIRVQLGGKEQG
VINQEAEEVSIPPHLMVGSSFELFDFIAAEVARFVNSESEEYQLPAGRQRELGFTFSFXL
SSGTLIKWTKGFSIEETVGEDVVSELTKAIERQGLDLRVAALVNDTVGTLAGGRYYDKDV
VAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDLSLDTE
SLNPGEQIFEKLISGMYLGEILRRVLLRLAEEASFFGDVVPPKLMVPFILRTPHMSSMHL
DTSSDLKVVSSKLKDILGITNTSLKMRKMVVRLCDIIAKRGARLSAAGIFGILKKQGRDV
PSEKQRTVIALDGGLFEHYTAFRNSLESTLTEMLGKEADSSVIITHANDGSGIGAALIAA
AHSQYLELDSS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaagtggtgatcggatcggtggtgatcggcgcggcgacggcgtgcgcggttgcg
gcgctgatcgtgaaacacaggatgaaaaaatcggggtggtgggcaaaagtggaggcgatt
gtgatggacttcgaggagaagtgtgcgacgccgatcgggaagctgcggcaggttgcagat
gcgatgatggtggagatgcacgccggacttgcatcagagggtgggagcaagctgaagatg
ctcatctcctacgtcgataatcttccgaagggtgatgagaaaggattattttatgcattg
gaccttggaggaactaacttccgtgtaatacgtgtccaattgggaggaaaagaacaaggt
gttattaatcaggaggccgaagaggtctctattccaccacatctgatggttgggagctcc
tttgaattatttgatttcattgcggcagaggtagcaagatttgttaattctgaaagtgaa
gaatatcagcttcctgctggcaggcagagagaacttgggttcactttctctttcncactt
tcttctggcactcttatcaagtggacgaagggcttctccattgaggaaacggttggcgaa
gatgtagtctctgagctgacaaaagccattgaaagacaaggtcttgatttgcgtgttgcc
gcactagtcaacgatactgttgggacactagctggaggacgctattatgataaagatgtt
gttgctgctgttattctaggtacaggtacgaacgcagcatatgtggagcgcgcacacgct
attccgaagtggcacggcctgttaccaaaatcaggagagatggtgatcaacatggaatgg
ggaaatttcaggtcatctcatcttcctttgacagaatatgatctctcattagatactgaa
agtttgaatcctggagaacagatatttgagaagttaatttcaggaatgtatttgggagag
attcttagaagagtgctgttgaggttggcagaggaggcttctttctttggggatgttgtg
cctccaaaacttatggttccatttatactgaggacaccgcacatgtcttcaatgcatctt
gatacatcctcagatctcaaagtagtcagtagtaaattgaaagacatattggggataaca
aacacctcactaaaaatgaggaaaatggtggtgaggctctgcgacatcatcgccaagcgc
ggcgcccggctatccgccgccggcatcttcggcattctgaagaagcagggaagggatgtt
ccctctgagaagcagagaacggtgattgctttggatggcgggctgttcgagcactacaca
gcattcaggaatagcttggagagcactctcacggaaatgctcggcaaagaagctgattct
tccgtcatcataacgcatgccaatgatggctccggcatcggtgcggctctcatcgccgcc
gcgcactcacagtatctggagctggattcttcctaa

DBGET integrated database retrieval system