KEGG   Phalaenopsis equestris: 110022221Help
Entry
110022221         CDS       T05601                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
peq  Phalaenopsis equestris
Pathway
peq00250  Alanine, aspartate and glutamate metabolism
peq00410  beta-Alanine metabolism
peq00430  Taurine and hypotaurine metabolism
peq00650  Butanoate metabolism
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
Module
peq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110022221
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110022221
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110022221
   00430 Taurine and hypotaurine metabolism
    110022221
Enzymes [BR:peq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110022221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110022221
NCBI-ProteinID: XP_020576710
LinkDB All DBs
Position
Unknown
AA seq 506 aa AA seqDB search
MALSRAQPDSSDAAIHCTFGSRYVRTALPRFRMPEQSIPKEAAYQIIHDELMLDGNPRLN
LASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAI
GVGTVGSSEAIMLAGLAFKRRWQNKMRAQGKPYDKPNIVTGANVQVCWEKFARYFEVELK
EVKLRDGYYVMDPQKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLMKKNKETGWET
PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEE
LIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNIMENCQENASILKSGLE
STGRFTIVSKDRGVPLVAFSLKDRSRHDEFEVSDYLRRFGWIVPAYTMPPDAQHVTVLRV
VIREDFSRTLAERLVADIQKVLHELDALPSKFLVIAAGAEGAAEKAEKVAGKDGLIVVKK
SEMETQRKVAKAWRKFVIAHKTNGVC
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggctctctctcgcgcccaacccgactcatcggacgccgcaatccactgcactttcggc
tcccgatacgtccgcaccgctctccccaggtttcggatgccggagcaatcgataccgaaa
gaggcggcttatcagatcattcatgatgagttgatgcttgatgggaatccgagattgaat
ctggcgtccttcgtcacgacgtggatggagccggagtgcgacaagctcatcatggcttcc
atcaacaagaactatgtggacatggatgagtacccagttaccactgagctccagaatcga
tgtgtcaacatgattgcccacctcttcaacgctcccctcggtgactccgagaccgcaatt
ggggtcggcacggtcggctcatcagaagccataatgctcgccggactcgccttcaaacga
cgatggcagaacaaaatgagagctcaggggaaaccctatgacaagcccaacattgtcaca
ggtgccaatgttcaggtttgttgggagaaatttgctagatattttgaggtggaattgaag
gaagtgaagctgagagatgggtactatgttatggatcctcagaaggccgttgagatggtg
gacgagaatacaatatgtgttgctgccattttgggctctactctcaatggagagtttgaa
gatgtaaagctgctgaatgatctgcttatgaagaagaataaggagacaggatgggaaaca
ccaatacatgtggacgcggctagtgggggattcatagcgccgttcctgtacccggagttg
gaatgggattttaggcttccccttgttaagagtattaacgtgagtgggcacaagtatggg
cttgtctacgccggcatcggctgggttatttggagaagcaaagaagacctgccagaagaa
cttatctttcacatcaactatcttggcgctgatcagcccaccttcaccctcaatttctcc
aaagggtcaagccaggtgattgcgcaatactatcagctaattcgcctgggcttcgagggt
tacaggaatataatggagaactgccaggaaaacgcatccatcctcaaatccggcctcgag
agcaccggccggttcaccatcgtctccaaggaccgtggcgtcccgctcgtcgccttctct
ctcaaagaccgaagtcgacatgatgaattcgaagtctccgactacctccgccggtttggc
tggatagttccggcctacacaatgccgccggatgcgcagcatgtgacggttctccgtgtc
gtcatccgtgaggatttcagccgcacgctggccgagcgccttgtggccgacatccagaag
gttctgcacgagctcgatgcactgccgtccaagttcttggtgattgcagctggggctgag
ggggcggcggagaaggcggagaaggtggctggtaaggatgggttgattgtagtgaagaag
tcggagatggagacgcagaggaaggttgctaaagcttggaggaagttcgttatcgcgcat
aagaccaatggggtttgctga

DBGET integrated database retrieval system