KEGG   Phalaenopsis equestris: 110022615Help
Entry
110022615         CDS       T05601                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
peq  Phalaenopsis equestris
Pathway
peq00620  Pyruvate metabolism
peq00710  Carbon fixation in photosynthetic organisms
peq01100  Metabolic pathways
peq01200  Carbon metabolism
Module
peq_M00168  CAM (Crassulacean acid metabolism), dark
peq_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
peq_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
peq_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    110022615
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110022615
Enzymes [BR:peq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     110022615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 110022615
NCBI-ProteinID: XP_020577318
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MSRSTVERHASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQEIHGEDIRETVQEC
YELSAEYEGNHDSKKLEELGHVLTSLDPGDSIVVAKSFSNMLNLANLAEEVQIAFRRRIK
LKKGDFVDENSAATESDIEETLRRLVHELKKSPEEVFDALKNQTIDLVFTAHPTQSVRRS
LLQKHGRIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTAPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRVRADELHRASKKDAKHYIEFWKQVP
PNEPYRVVLADVRDKLYNTRERSRHLLSSGYSDIPEETTLTNVEQFLEPLELCYSSLCTC
GDRPIADGSLLDFMRQVSTFGLSLVRLDIRQESDRHTDVLDAITTHLGIGSYRDWSEEQR
QEWLLSELSGKRPLFGPDLPKTEEIADVLDTLRVIAELPHDSFGAYIISMATAASDVLAV
ELLQRECQVKKPLRVVPLFEKLADLEAAPAALSRLFSINWYRNRIDGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEDLIKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALLDEMAVVATK
EYRSIVFQEPRFVEYFRLATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGTAFKHAIAKDIKNLNMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSDDLWSFGERLRANFEETKTLLLQVAGHRDLLEGDPYLKQRLRLRDAYITTLNVCQA
FTLKRIRDPSFHVNLRPHLSREIMNSNKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
LQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggagcaccgtggagaggcacgcgtcaattgacgcgcagcttaggctgctggct
ccgcgaaaggtgtcggaggacgacaagctggtggaatacgacgccttgctgctggatcgc
tttctagacatccttcaggagattcatggagaggatattagagagacggttcaagagtgt
tatgagctttctgctgagtatgagggcaaccatgactcgaagaagctggaggagcttggg
catgtgctgaccagtttggatcctggcgattccatagttgttgccaagtccttttcgaac
atgcttaatcttgccaacttggctgaggaagttcagattgcctttcgcaggagaattaag
ttgaaaaaaggagattttgttgatgagaattctgcagctacggaatcagatattgaagag
actcttaggaggcttgtacatgagctgaaaaagtcccctgaggaagtttttgacgctttg
aagaaccaaactattgatcttgtttttactgcacatccaactcagtcggtcaggaggtcc
ttgcttcagaagcatggcaggataaggaattgcttggctcaattgtatgccaaagatatc
actcctgatgacaagcaggaacttgatgaagcccttcagagagagatacaagccgctttc
aggactgatgaaattcgtagaactgcccccactcctcaagatgaaatgagggctggaatg
agttacttccatgaaactatatggaagggtgtcccgaagtttcttcggcgtgttgatact
gctctgaaaaatattggaatcaatgagcgagttccttataatgctcctcttattcaattc
tcttcatggatgggtggcgatcgtgatgggaatcctagagttactccagaagtcacgagg
gatgtgtgcttattggcaagaatgatggctgcaaacttgtacttctcccagatagaagat
ttaatgtttgagttatctatgtggcggtgtagtgatgagcttcgagttcgagcagatgaa
ttacaccgggcatcaaagaaagatgcaaaacattatatagagttctggaaacaagttcct
ccaaatgaaccatatcgcgttgtacttgctgatgttagggataagttatacaatacacgt
gagcgttctcgtcatcttttgtcaagtggatactctgacattcctgaggaaaccacgctt
accaatgttgagcagttccttgagccccttgagctctgctacagttctctctgcacctgt
ggtgatagacctatcgctgatggaagccttcttgacttcatgcgtcaagtatcaaccttt
ggcctctccctagtgagacttgatatcaggcaagaatctgatcgacatactgatgttctt
gatgctattaccacacatcttgggataggttcatatcgtgattggtctgaggagcaacgt
caagagtggcttctatctgaactgagtggcaagcgccctttatttggtccagaccttccc
aaaactgaggaaattgctgacgttcttgacacattacgtgtcatagcagagcttcctcat
gatagttttggagcttacataatttccatggcaactgctgcatctgatgtgcttgcagtg
gagcttttgcagcgtgagtgccaggtgaagaaaccattgagagtcgtgccactttttgag
aaacttgcggatctagaggcagcacctgcagctttatcccgtctcttctcaatcaactgg
tacaggaacagaattgatggaaagcaggaggtcatgattggttattcagactctgggaag
gatgcgggacgtctttctgcagcttggcagctgtataaagctcaagaagatctgataaag
gttgcaaaagagtttggggtgaaactgacaatgttccacggacgagggggaactgttgga
agaggaggtggccctacccatctggctattttatctcagcctccagatacaattcacggt
tcgcttcgagtgactgttcaaggtgaagtaattgaacaatcttttggagaggagcatttg
tgtttcagaactcttcagcgttttactgcagccacacttgagcatggtatgcatccacca
atttcaccaaagccagaatggagagcattgctggatgagatggctgttgttgccacaaaa
gaatatcgctctattgtcttccaagaaccacgttttgtcgaatactttcgtctggccaca
cctgagacggaatatggtagaatgaacattggaagccgaccatctaaacgaaaacccagt
ggaggcatagaatctctacgagcaattccatggatttttgcttggactcaaacaaggttc
caccttcctgtttggcttggtttcgggacagcattcaagcatgccattgcaaaggacata
aaaaaccttaacatgctacaagagatgtataatgaatggcctttctttagggtcaccatc
gacttagttgagatggtgtttgctaaaggagatcctggcattgctgcattatatgacaaa
ctgttggtttccgatgatttgtggtcatttggggagaggctcagagctaactttgaagaa
accaaaactcttcttcttcaggttgctggacatagagatcttcttgaaggagacccctac
ttgaaacagagactgcgcctccgcgacgcgtacatcactactctgaatgtgtgccaagcc
ttcaccctcaaaaggatcagagatccaagctttcatgtaaatctgaggcctcatttatca
agggaaataatgaattccaacaagccagctgcagagctggtgaaactcaaccccacaagt
gagtatgctcctgggctggaggataccctcatcctgaccatgaaaggtattgctgctggg
ctgcagaacactggttaa

DBGET integrated database retrieval system