KEGG   Phalaenopsis equestris: 110025279Help
Entry
110025279         CDS       T05601                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 9-like
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:peq01003]
    110025279
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:peq02000]
    110025279
Enzymes [BR:peq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     110025279
Glycosyltransferases [BR:peq01003]
 Polysaccharide
  Structural polysaccharide
   110025279
Transporters [BR:peq02000]
 Other Transporters
  Others
   110025279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 110025279
NCBI-ProteinID: XP_020581340
LinkDB All DBs
Position
Unknown
AA seq 536 aa AA seqDB search
MESGTSSATLGILPETFQLGRDDIAGQIALIWEQVKAPVIVPLLRVATFLCLVMSVMLFV
EKVYMAVVIVAVKLSGRRPERRYKWEPLQEDLELGNSAFPMVLVQIPMYNEKEVYKLSIG
AACGLSWPSDRIIIQVLDDSTDPIIKDLVVMECERWASKGINIKYEIRDNRNGYKAGALK
EGMKHSYVKSCDFVAIFDADFQPEPDFLTRTIPFLVHNPKLGLVQARWKFSNSNECLMTR
MQEMSLDYHFTVEQEVGSSIYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAS
LKGWKFVYLSNLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMLMEIVRNKKVSLFKKIH
VIYNFFFVRKIVAHIVTFVFYCVVIPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSL
HLIVFWILFENVMSLHRTKATFVGLLETSKVNEWIVTEKLGDALKTKTIAKASKKMKIRI
GDKLHVLELGVGVFLFFCGFYDLAFGRNHYFIYLFLQGLAFFAVGFGYVGIYVPHS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgggacttcgtcggcaacattggggatacttccggagacatttcagttgggg
agggatgacattgccggccagatagcgctgatctgggagcaggtgaaggctccggtgatc
gtcccacttctgcgcgtggcgacttttctttgtcttgtgatgtcggtgatgcttttcgtc
gagaaggtatacatggctgtcgtcatcgtcgctgtcaaactctccggccgccgccctgag
aggcgctacaaatgggagccactacaggaggaccttgagctcgggaactccgcattcccc
atggttctcgttcaaatccccatgtacaacgaaaaggaggtctacaagctctccattgga
gctgcatgcgggctctcctggccgtccgatcggatcatcatccaggtgcttgacgattct
accgaccccatcatcaaggatctggtggtgatggaatgcgagagatgggcgagcaaggga
atcaacataaagtacgagatacgtgacaaccggaacgggtacaaagccggcgccctgaag
gaggggatgaagcatagctatgttaagagctgtgatttcgtcgccatattcgacgccgac
ttccagcccgagccagacttcctcacccgcaccattcccttcctcgttcacaaccccaaa
ctcggcctcgttcaggctcgctggaaattctcgaactccaatgaatgtctgatgactagg
atgcaggagatgtccctggattaccatttcactgttgagcaggaggttgggtcctccata
tattccttttttggcttcaatgggactgctggggtgtggcggatatcagctctaaatgaa
gcaggaggttggaaggatcggaccaccgtagaggacatggacttggctgttcgagcaagc
ctcaaaggttggaaattcgtatacctatcaaatcttaaggtaaaaaatgaattgccgagc
accttcaaagcttatcgatatcagcaacacaggtggtcatgtggtcctgcaaacttgttc
aggaaaatgcttatggagattgtaagaaacaagaaagtatctctatttaagaaaatacat
gtgatctacaatttcttctttgttcgaaaaattgttgctcatattgtcacctttgtgttc
tactgtgtggtcatcccggcaactgtcttagttcctgaagtagaagttccaaagtggggt
tcagtctatatcccatccatcatcacccttcttaatgctgttggaactccaagatctctc
cacttgatagtattctggatcctttttgagaatgtcatgtctttgcatagaacaaaggct
acctttgtaggcctcttagagaccagcaaggttaatgaatggatagtcactgagaagcta
ggtgatgcgttgaagacgaaaaccattgctaaagcatctaagaaaatgaaaattcggatc
ggcgataagttacatgtgttggagctaggggtgggagtcttcctcttcttctgtgggttc
tatgatttggcatttgggaggaaccattacttcatatatctgtttctccagggcttggca
ttttttgctgtaggttttggttatgtaggcatatatgtcccacactcctga

DBGET integrated database retrieval system