KEGG   Phalaenopsis equestris: 110026758Help
Entry
110026758         CDS       T05601                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
peq  Phalaenopsis equestris
Pathway
peq00071  Fatty acid degradation
peq00592  alpha-Linolenic acid metabolism
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
peq01212  Fatty acid metabolism
Module
peq_M00087  beta-Oxidation
peq_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110026758
   00592 alpha-Linolenic acid metabolism
    110026758
Enzymes [BR:peq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     110026758
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     110026758
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110026758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 110026758
NCBI-ProteinID: XP_020583518
LinkDB All DBs
Position
Unknown
AA seq 722 aa AA seqDB search
MAKGSTTIEVGADGVAVITIVNPPVNSLSIDVLYSLKDNYEQALKRNDVKAIVVTGARGK
FSGGFDISAFSAIQGGDTRQPNADFISIEIVTNTLEAAKKPSVAAIDGLALGGGLEIAMA
CHARISTSNAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILLSKSVKGEEGHSLGL
VDAIVPPDQLVITARQWALDIIEFRRPWIRSLFKTDKLEPLGEAREILTFARAQAKKQAA
NLQHPLVCIDVIEEGIVSGPLAGLRKEASSFQQLLVSDTCKCLVHVFFAQRATSKVPGIT
DLGLTPRKTKKVAVLGGGLMGSGIVTVLIMSGFPVILKEVNKDFLKAGIDRIKANLQSQV
KKGKMTDEKFEKTISLVKGVLDYECFRDVDVVIEAVIENVSLKQQIFADLEKYCPSHCIF
ASNTSTIDLDLIGEKTSSQDRIVGAHFFSPAHVMPLLEIVRTSKTSPQIVVDLMDIGKKI
RKTPIVVGNCTGFAVNRMFFPYTQSALLFVDRGLDVYNIDRACSKFGMPMGPFRMIDLVG
FGVGVATGIQYLQKFPDRSYKSVLMPLMLEDKRSGEAALKGFYKYDNRRKAIVDPEINKY
IEKSRKMAGVTPDPELLKVSDKDIVEMVFLPVVNEACRVLDEGIAVKASDLDIASIMGMG
FPPYRGGIIFWAESLGVSYIHKRLEEWTKKYGNFFKPCAYLTERAANGRPLSASAERGKA
RL
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagggtcgacaacgattgaggtgggtgctgacggcgtggctgtcatcactatt
gttaatcctccagtgaattctctctcgatcgatgttttatacagtctgaaagacaattat
gagcaagctttgaaaagaaatgacgtgaaagcaattgttgtcaccggtgctaggggaaaa
ttttctggaggttttgatatcagtgcattcagcgcaattcaagggggagacaccagacaa
cctaatgcggactttatttcaattgaaattgtcaccaacaccttggaagctgcaaaaaaa
ccatcagtagctgctattgatggtctggcacttggtggtgggttagagattgccatggca
tgccatgcacgcatttctacttcaaatgctcagctaggcttgcctgagctccaacttggt
gtcatcccaggatttggaggaactcaacgactcccacgccttgtgggccttactaaagct
cttgaaatgatcttgttgtctaagtcagttaaaggagaagaaggccattcattgggtctt
gttgatgccatagttccacctgatcaattggtcattactgctaggcaatgggctttggat
attattgaatttagaagaccatggataagaagcctttttaaaactgataaattggaacca
ttaggagaggccagggaaattcttacgtttgccagagctcaagctaaaaaacaagctgcc
aatctccagcatccgttagtctgcattgatgtaatagaagaaggcatagtgtcaggacct
ctagctggacttcggaaggaagccagttcgtttcagcaacttcttgtctctgacacatgc
aagtgcttggtccatgtgttctttgcacaacgtgctacctctaaggtacctggtattact
gacttaggtttaacacctagaaaaacaaaaaaagttgctgttcttggcggaggcctgatg
gggtctggaattgtaactgtattgataatgagcggttttccagttattcttaaagaagta
aacaaagacttcctgaaagctggaattgacaggatcaaagccaatctgcaaagtcaagtg
aagaaagggaaaatgactgatgaaaagtttgagaagacaatttcactcgtcaaaggagtt
cttgattatgaatgttttagagatgtggacgttgtcattgaggcagttatagagaatgta
tctttgaagcagcagatattcgctgatctggagaaatactgtccttcacattgcatcttt
gcaagtaatacttcaacaattgatttggatttgattggagaaaagaccagttcacaggat
cgtatagttggtgctcatttctttagtcctgctcatgtgatgccacttctggaaatagtt
cgtaccagtaagacctcaccacagatcgttgtggacttgatggatataggaaagaagatt
cgcaaaacaccaatagttgttgggaactgtactggttttgcagtcaaccgaatgttcttt
ccttacactcagtcagcgctcttatttgttgataggggtctagatgtctacaatatcgat
cgggcatgttctaagtttggaatgcctatgggccctttcagaatgattgatcttgtgggc
tttggggttggagtggctactggcattcaatatcttcaaaaatttcctgataggtcctac
aaatcagtgttgatgccgcttatgcttgaggataagcgatcaggggaagctgctctaaag
gggttctacaaatatgacaataggcggaaagctattgttgaccctgaaataaataagtac
attgaaaaatcaaggaaaatggctggtgttacacctgatcctgagttactgaaggtttca
gataaagatattgtagaaatggtttttctgcctgttgtgaatgaggcttgtcgtgttctt
gatgagggtatagctgttaaggcatcagaccttgatatcgcatctatcatgggcatgggc
ttccctccatacaggggtggtatcatcttctgggctgaaagtcttggagtaagctacatc
cacaagagattggaagagtggacaaaaaaatatggcaatttcttcaaaccatgcgcctat
ctgacagaacgtgctgctaacggccgtccattgagtgcatctgctgaacggggaaaggct
cggctctaa

DBGET integrated database retrieval system