KEGG   Phalaenopsis equestris: 110027217Help
Entry
110027217         CDS       T05601                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
peq  Phalaenopsis equestris
Pathway
peq03030  DNA replication
peq03410  Base excision repair
peq03420  Nucleotide excision repair
peq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:peq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110027217
   03410 Base excision repair
    110027217
   03420 Nucleotide excision repair
    110027217
   03430 Mismatch repair
    110027217
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:peq03032]
    110027217
   03400 DNA repair and recombination proteins [BR:peq03400]
    110027217
Enzymes [BR:peq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110027217
    6.5.1.6  DNA ligase (ATP or NAD+)
     110027217
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110027217
DNA replication proteins [BR:peq03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110027217
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110027217
DNA repair and recombination proteins [BR:peq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110027217
   NER (nucleotide excision repair)
    Other NER factors
     110027217
   MMR (mismatch excision repair)
    Other MMR factors
     110027217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase TrmB
Motif
Other DBs
NCBI-GeneID: 110027217
NCBI-ProteinID: XP_020584209
LinkDB All DBs
Position
Unknown
AA seq 784 aa AA seqDB search
MYFLLYSPLSRHYIIHTNTPEVHTLRRRALRPPTSLRFMLLRVHILHSLRCPSPTTSDLS
SLLKNPNKTPLSLISTSSQRHTMASGRTVTDVLMGASRAAAAKKNRHSSSSESQNPSSTP
KKPRTVEPSTVSDEPKKLEATDFLLELRKKGADFDPKAAASWKDGDPVPFNFLARALDLI
SNESGRIAITDIICNVFRTVMATTPDDLLPTVYLSANRIAPPHEGIELGIGDASLVKALA
EAYGRKEEHVNKQLQELGDLGLVAKASRSSQRVLYKPQRLTVVKVFDTFRAIAKESGKDS
QDKKRNYIKGLLVAATDCEPLYIIRLLQSKMRIGLAEKTVLVALGQASLYSEGLQGAPVK
NLSQSLEEAAKIMKQVYSVLPDYGKIVPALLHAGILKLSEACDFSLGVPVGPMLAKPTKS
VSEILDKFQGTEFTCEYKYDGERAQIHYMEDGTIEIYSRNAERNTGKYPDVVSSVSRFKK
PEVNSFVLDCEIVAFDGEKQKILPFQVLSTRARKGVILSDIKVAVCTFAFDILYINGRPL
LHEQLKVRKEELYKCFVEIPGEFSFATAITSNDLEEIQKFLENAVSSSCEGLIIKTLDKD
ATYAPSKRSNNWLKLKKDYMDSVGDTLDLVPIAAFHGRGKRTGVYGSFLLACYDEQNDEY
QSICNIGTGFSELQLEERSKSLGSKVISKPKPYYRVADSMNPDVWFEPAEVWEVKAADLS
ISPVHRAAFGIVDPNKGISLRFPRLQHVRDDKNPEQATTSEQVAEMYRAQKINHMKNQEE
EDDE
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgtacttcttgctgtattctcctctatcccgccattacataattcacacaaacacacca
gaagtccacactttgcgccggcgcgccctgcgtcctcctacgtctctgcgtttcatgctc
ttgagagtacacatactccattccctccgatgcccatctcctactacctccgatctctct
tcgcttctcaaaaaccctaacaaaaccccactctctcttatatccacttcttcgcagcga
catacaatggcgtccggccgtacggtcaccgatgtcctcatgggcgcctcccgcgccgca
gcagctaagaagaaccgccattcttcatcatccgagtcccagaacccttcttcaactccc
aaaaaacccagaacagttgaaccctcaactgtctcggacgaaccaaagaagttggaagcc
accgattttctcctcgaactcaggaaaaagggcgccgattttgaccccaaagctgccgca
tcatggaaagacggcgacccggtgccgttcaacttcctcgctcgcgcactagatcttatc
tcgaacgagtcgggtaggatcgcgatcacggacatcatctgcaacgtcttccgcactgtt
atggccaccactcctgatgaccttctccccacggtttatctgtcggctaataggattgct
cccccgcatgagggcatcgagctgggaataggagatgcttcacttgttaaggcgctcgct
gaagcttatgggaggaaggaagagcatgtcaataagcagctacaggaattaggtgacttg
ggccttgttgctaaagctagtagatcatcacagagagttttatataagcctcagcgtttg
actgtcgtcaaagtttttgacacttttcgtgccattgcaaaggagtctggaaaagacagt
caagacaagaaaagaaattacattaaaggtcttcttgttgctgctactgattgtgagcca
ttatacataattcgccttcttcagtccaaaatgagaataggtttggcagagaaaacagtg
cttgtggctcttgggcaagcatctctgtattcagaaggacttcagggtgcacctgtgaaa
aatttgtctcagtcattggaagaggccgccaaaatcatgaaacaagtatattctgttctt
ccggactatggtaaaattgttcctgctcttcttcatgctgggatactgaaactttcagag
gcatgcgatttctctttgggtgtgccagtggggcctatgttggctaaacctacaaaatca
gtctctgagattctagataagtttcaaggaaccgaatttacatgtgaatataagtatgat
ggtgagcgtgctcagatacattacatggaagatggcaccatagagatatacagccgtaat
gctgaacgaaatactggaaagtaccctgatgtggtcagttctgtgtcaagatttaagaag
cctgaagtaaactcctttgtgttggattgtgaaattgttgcttttgatggtgagaagcag
aagatcttacctttccaggttttgagcactcgtgctcgcaaaggtgtgatcttaagtgac
ataaaagtagctgtatgcacatttgcttttgatattctctacattaatggaaggcctctc
ctccatgaacaactcaaagttcgcaaggaggaactttacaaatgttttgtggagataccc
ggagaatttagttttgctactgcaataacatctaatgatcttgaagaaatacagaagttt
ttagaaaatgctgtcagctccagttgtgaagggttgattatcaaaactttggacaaggat
gctacatatgcgccttcaaaacgatcaaacaactggttaaaattgaaaaaggattatatg
gacagtgtaggagacactttagatctggtgcccattgcagccttccatggccgcggaaaa
cgcacaggtgtttatggttcttttcttcttgcttgctatgatgaacaaaatgatgaatat
caaagcatatgtaacattggtactggattttctgaattgcagcttgaagagaggtccaaa
agtcttggaagtaaagttatttcaaaaccaaaaccatactacagagtagctgattcaatg
aatcctgatgtctggttcgaacctgcagaggtttgggaagtaaaggcagcggatttgagc
attagtcctgttcatcgtgccgcttttggcattgtggatccaaataagggtatttctctg
cgatttcctcgtctacaacatgtccgagatgacaaaaacccagaacaagccacaacatct
gagcaggttgctgagatgtatcgtgcacaaaagatcaatcatatgaaaaatcaggaggaa
gaggatgacgaatga

DBGET integrated database retrieval system