KEGG   Phalaenopsis equestris: 110027552Help
Entry
110027552         CDS       T05601                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
peq  Phalaenopsis equestris
Pathway
peq00020  Citrate cycle (TCA cycle)
peq00190  Oxidative phosphorylation
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
peq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110027552
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110027552
Enzymes [BR:peq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110027552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 110027552
NCBI-ProteinID: XP_020584701
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MWRAAFSQALRISSSKKVSVGTDIVSSSSRFFSTGSSSYTIVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ
DAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRT
GHALLHTLYGQAMKHNTQFFVEYFALDLLMDSSGSCQGVIALNMEDGTLHRFCAKSTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVIHIEGSDPDAVVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGERTIA
WLDKLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCNLIDKAWESFHDVKVSDR
TLIWNSDLIETLELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHSLGYWE
NEKVRLAYRPVHMNTLDDEIEPFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtgcagctttctcccaagcacttcgtatttcctcctcgaagaaagtatcggtt
gggactgatatcgtctccagttcttcgaggtttttctccactggctcgtcttcatacacc
attgttgatcacacatatgatgctgtagtagttggagctggtggtgctgggcttagagca
gctattggactttcagaacatggtttcaatactgcttgcatcacaaagctcttccccact
agatctcatactgttgctgcacagggtgggattaatgcagcattgggaaatatgagtgag
gatgattggagatggcacatgtatgacactgtcaaaggaagtgattggttaggtgatcag
gacgctattcaatatatgtgtagagaggcacctaaggcagtcattgaacttgaaaactat
gggctgccattttctagaacagaagatggaaaaatatatcaacgtgcttttggggggcaa
agcttgaattttggaaaaggtggccaagcctatcgctgtgcttgtgctgctgatcgcact
ggtcatgcattattacacactctttatggccaggcaatgaagcataacactcagttcttt
gttgaatattttgcactggatcttcttatggatagtagtgggtcctgtcaaggggtgatt
gcactcaacatggaggatggaacgcttcatcgtttctgtgccaaatccacaattttagcc
actgggggctatggaagagcttacttttctgcgacctctgctcatacatgcactggagat
ggtaatgctatggttgctcgtgctggtttacctcttgaggatcttgagtttgtacagttc
catcctactggcatttatggtgcaggctgtttgattactgaaggatctcgtggtgaaggt
ggcattcttaggaacagtgaaggtgaacgtttcatggaacgttatgctcctactgcaaag
gatcttgcttcaagggatgtagtttcaagatctatgactatggaaattcgagaaggtcgt
ggtgttggaccactaaaggatcacatttatctacacctgaatcacctacctccagaggtg
ctcaaggaaaggcttcctgggatatcagagactgctgcaatttttgctggagttgacgtc
accaaggagcctatccctgtgctacccacagtacactataatatgggtggaatccccaca
aactaccatggcgaggtaattcacattgaaggtagtgatccagacgcagtagttcctggt
ctaatggctgcgggtgaggcagcctgtgcatcagttcatggagcaaatcgccttggtgcc
aattcgcttctagacattgttgtatttggcagagcttgtgcaaatagagttgcagagatt
cacaagccaggtgagaagcaaaaacctcttgaaaaggatgctggggagaggacaattgct
tggcttgataaacttagaaattccaatggctccttaccaacctcaaaaattcgtctcaat
atgcaaagggtaatgcaaaataatgccgctgtatttagaactcaggagacgttggaagaa
ggttgcaacttgattgacaaagcgtgggagagttttcatgatgttaaagttagtgatcga
accctgatatggaactctgatctgatagaaactctcgagttagaaaatcttttgattaat
gcctgtataaccatgcattctgctgaagcacggaaagaaagtagaggagctcatgctcgt
gaagattttactaaaagagatgatgagaactggatgaagcattcacttggatactgggag
aatgaaaaagttcgactggcatatagacctgtccatatgaatactctggatgatgaaatt
gaaccattcccaccaaaagcacgtgtttattga

DBGET integrated database retrieval system