KEGG   Phalaenopsis equestris: 110028242Help
Entry
110028242         CDS       T05601                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
peq  Phalaenopsis equestris
Pathway
peq00010  Glycolysis / Gluconeogenesis
peq00020  Citrate cycle (TCA cycle)
peq00620  Pyruvate metabolism
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
peq01200  Carbon metabolism
Module
peq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110028242
   00020 Citrate cycle (TCA cycle)
    110028242
   00620 Pyruvate metabolism
    110028242
Enzymes [BR:peq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110028242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 110028242
NCBI-ProteinID: XP_020585664
LinkDB All DBs
Position
Unknown
AA seq 480 aa AA seqDB search
MPSMALHFATSSFAAAAAGNSISFSSSLSSSLPTLPSRCLLRRRRPTRIATVRAKIREIF
MPALSSTMTEGKIISWIKTEGDRLSKGESXVESDKADMEVETFYDGILASIVVPEGEIAP
VGAPIGLLAESEEEVALAKAKAQSPSQSQQAPVSAPPPSPVAAAPIPSPSPSPVSAEGPR
KLVATPYAKKLAKQHKVDIGSVVGTGPYGRVTPQDVELAAGIQTKKPSPTPAAAPTPVSK
GAAVAPLAEKAVLPPIPGSTVVSFTTMQAAVSKNMLESLLVPTFRVGYPVITNALDALYE
KVKSKGVTMTVLLAKAAAMALAQHPVVNASCKDGKSFSYNSNINIAVAVAIDGGLITPVL
QDADKLDIYLLSQKWKELVSKARSKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPGQGA
IMAVGASKPTVVAGAGGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIIENSDSLTL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaatggcgcttcacttcgccacctcctccttcgccgccgctgcggccggcaac
tccatttccttctcttcatccctttcctcctccctacccaccctccccagccgctgtcta
ctccggcgccgccgcccgactcgcatcgcaacagtacgcgccaagatccgcgagattttt
atgccggcgctcagctccaccatgaccgagggcaagatcatctcctggatcaagaccgag
ggcgatcgcctctccaagggcgagagcngcgtcgagtcggacaaggccgacatggaggtc
gagaccttttatgacggaattctagcctccatcgttgtacctgagggcgagatcgccccc
gtcggggctccgatcggtctccttgccgagtccgaggaagaggttgccctagccaaagcc
aaggcgcagtctccctcgcaatcccagcaggctcctgtttctgctcctcccccgtctccg
gttgcagccgctcccatcccttctccctctccatcgccggtgtcagctgagggaccgagg
aaattggtagccacgccctacgcgaagaagctcgcgaagcagcataaggtggatattggc
tctgtggtgggtactgggccctatgggagggtcactcctcaggatgtggagctggctgcc
gggatccagactaagaagccttctccgactcctgcggcagctccgactcctgtgtcaaaa
ggcgccgcagttgctccgcttgctgagaaagctgttttgcctccaatcccgggctcaaca
gtggtatccttcacgacaatgcaggcagcagtgtcgaagaacatgttggaaagtttattg
gttcccacatttcgggttggatatccagttatcactaatgcacttgatgcactttatgaa
aaggttaagtcaaaaggggtgacaatgactgttctgttggcaaaggctgcagctatggca
cttgcacagcatccagttgttaatgctagctgcaaagatgggaagagcttcagttataat
agcaacatcaatattgcagtggccgtggcaattgatggtgggcttataactcctgttctc
caagatgctgataaactggatatctatcttctttctcagaaatggaaggaacttgtgagc
aaagctcgatctaaacagctccagcccaatgagtacaattcaggaacatttactctatcg
aatcttgggatgtttggagtagatagatttgatgctattctccctcctggtcagggggct
attatggctgttggagcatccaagccaacagttgtggcgggtgcgggtggtttcttttct
gtaaagaataaaatgctggttaatgtgacagcagatcaccggattatttatggtgcggat
ttagctgctttccttcagacattttcaaagataattgaaaattctgacagcttaactctg
taa

DBGET integrated database retrieval system