KEGG   Phalaenopsis equestris: 110028596Help
Entry
110028596         CDS       T05601                                 

Definition
(RefSeq) bZIP transcription factor 39-like isoform X1
Organism
peq  Phalaenopsis equestris
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS6_N ZapB CENP-F_leu_zip
Motif
Other DBs
NCBI-GeneID: 110028596
NCBI-ProteinID: XP_020586164
LinkDB All DBs
Position
Unknown
AA seq 681 aa AA seqDB search
MPEFAATDPFSPQVGLSFNPDFLESHFLPDDLCLPSGGPSSEIDLDFDFDGIDWDISVDD
LLLPENANPPSHPSPTSSDGWLPESVVLTSSSSPATSGIINITSPESDRSADCSTESSAD
VKREEENGRGTKIIKKREVGSGKTNINPRSSKSRRLEDFGSCRPNAVSEEEEKKKARLIR
NRESAQLSRQRKKEYVEELEDKVRSMSSTIAELNSKISFIMAENLSLKQQLGGSSFPPGV
YPPPSFASSHFSWAPYPPLVFRQQISPVPLVPIPKLKSQQAEASQKTGICEKKKRENKVR
KVASISLLGFLFFVLIYGGLTGRVDHRYQENRDFGEVTVKNGLLGYPKGMVLSVSGRTRS
LTSSEEVGFNNGRKSKSGVDKCFQNAKVGSEAKPWPFGGRMVTQNSSESLPACLYVPRNG
KHVEINGNLIISSVLASEKAVAQVKSRDQPKHPSGNDVIGTGLVIANLDSGVALSTKDIG
GRTKSHGSSTEYQGALASDAEDACMDNSQDGFLEQWFQEGMAGPIFSSGTCTEVFQFQIS
PSSASPSAVITSSIINATKTAVANSSTGSTSSSAPQRVIKNRKFFYPRAIPLPGSTGNHT
KRIGKGPEGSNFQSNASGPPMVVSVLIDPREVSDGDGDGEGKISPNKSLQRIFVVILLDS
VKYITYSCVLPFKSYSPHLVN
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgccggagtttgccgccaccgatcccttctccccgcaagtcggcctttcgttcaaccct
gactttctcgaatcccatttcttaccggacgatctgtgcctccccagcggcggcccttca
tctgaaattgatcttgattttgatttcgatggcattgattgggatatatccgttgacgat
ctcctcctccccgagaacgcaaaccctccatctcatccctctcctacatcgagcgacgga
tggctgccggaatctgtagtgttgacctcctcctcctctccagctacctctggcatcatc
aacatcacttcccctgaatccgaccgctccgccgactgttccacagaatctagcgcggat
gtgaagcgggaggaggagaacgggcgggggacgaagataataaagaagcgggaggtggga
agcggtaagactaacataaaccctagaagcagcaaatcccggcggttggaggattttggg
tcatgtaggcccaacgctgtgagtgaggaagaggagaagaagaaggcgagactaataagg
aaccgggagagcgctcagctttcgaggcagcggaagaaggagtatgtggaggagctggag
gataaggttcggtccatgagctctacgatcgctgaattgaacagtaagatctcgtttatc
atggcggagaatctgagtctaaagcaacagttgggtggtagtagctttccgcctggtgtt
taccctccgccttcttttgcctcctcgcatttttcttgggctccttatcctccgcttgtg
tttaggcagcagatttctccagttccactggttcctatacccaaattaaagtcccagcaa
gctgaagcctcccaaaagacagggatatgtgagaagaagaagcgtgaaaacaaagttagg
aaggtggcaagcatttcacttttggggtttttattttttgtattgatatatggaggtctg
acagggagagtagatcatagataccaagaaaacagagattttggagaagttacagttaaa
aatggtttgttgggttatcctaaaggtatggttctgagtgttagtggccgtactaggagt
ttgactagttctgaagaggtcggcttcaataatggaagaaaaagtaaaagtggagttgat
aagtgttttcagaatgcaaaggtgggatcagaagccaaaccatggccttttggtggccgc
atggttacccagaattctagtgagagtcttcctgcttgtctgtatgtcccaagaaatgga
aagcatgtcgagatcaatgggaacttgataatcagttctgttcttgccagcgagaaagct
gtggcacaggtaaaatccagagatcagcctaagcatccctctggaaatgacgttattggg
acaggtctggtgattgctaatctggattctggtgtggctttatcaactaaggatattggt
ggacgtaccaagtcacatggtagctcaactgaatatcagggagcacttgcttctgatgct
gaagatgcatgtatggacaattcgcaggatggatttcttgaacaatggtttcaggaagga
atggcaggcccaatattcagttctggcacatgcactgaagtgttccagtttcaaatctcc
ccttcatctgctagtcctagtgcagtcatcacttcttcaataattaatgcaacaaaaact
gcggttgccaattcaagtacgggcagcacttcatcatctgcacctcaaagagtgataaag
aaccgaaaatttttctatcctcgagctattccactccctggatctacaggtaaccacact
aaacgcatagggaaaggacccgaaggcagcaactttcagagtaatgcctctggtcctccc
atggttgtctctgtcttgattgatcctagagaagttagtgatggtgacggtgatggggag
ggaaaaatatcacccaacaaatcacttcaacgtatttttgtagttatacttcttgatagt
gtcaaatacatcacatattcttgtgtgcttccgttcaagagctatagtcctcatcttgta
aactaa

DBGET integrated database retrieval system